Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031509 (1700016D06Rik)
Chromosomal location
Chr 8: 11654921 - 11678750 (-)
Description
RIKEN cDNA 1700016D06 gene Gene [Source:MGI Symbol;Acc:MGI:1923663]
RefSeq_dna
NM_024271 
RefSeq_peptide
NP_077233.1 
UniGene
Mm.440041 
MGI
MGI:1923663 
Uniprot/SPTREMBL
Q9DAA5 
Human Ortholog
not available
Omim not available
UniTrap UNI16132
Vector Insertion
Chr 8: 11665099 - 11678575
Public Clones not available
Private Clones OST466165 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033906
Sequence
CATTCCACGTATCCGAGAGATCAAGGCTGGGGAAGCTGAAGACCTTCCAGGGAAGGGCCTCCTCCTTCTGCTGGAGGGACCATGACAGCGAATAGAGGAG

CAATGACCTTCTTATCTGTCTTCCTGCTGTGCTGTTGGCAAGACGTACAGCCCTGGCCGAATAGAGAGCTTTCAG - UNI16132 - GTTCAAGTGGT

AAGCAATGGCCAAATTTAGAAACTCTGGATGATGACATAGCTACAGTGTTTG ATGAAATTCTAGTCCGGGATATTCTGGAGCCAGGGAAAGCACCATAT

TTTGAAAATCAAAGCCCATCAACAACTTCACAACAAAAAACAACGAAGGAAAAAG AAGTCCACACAAAAGAACCCATACCTTCTAAGACATATCAGAAG

CAGTCATCTTCTGGGACCATGCACACCCCTTCCTTTGACG ATAAGCAGAAAGAAATACTTTTTCAGCTAAGAAGCCTTGAAGCTCTGGAGAAAATGATT

GACAAGATTCGAAGAGCTATTG AAACTAAGCTCAAGAGAAGACAGAAGCTCCAGCAAAGTAGAAGCAGTCAACTCCTGGGGAAGCCAATCCAGCCCTAA

GTACTAGGCCTGGCGAGAGGGACAAGCCACTGCCGCACATGGGGACAGAAGAGAGTGGAAGGAGCCATCGACCTGTGTGAACTGTACTCAATGAGCACCA

AATAAAATTAGCATATTTAAATATTAAGTTATCTGATAGGGCTGTTTTATTTCTTCATTATTTTATTATTATTATTCAAAATGGGGAGAGAAAACTGGAA

CTGGGGGGCATGGGGAGGGGTGGAACCCTAGTGCAGTGATAACTCCTAGTAACGAAGGAGGACTCACAGTGATGGAAGATACAGAGCCTGCACCTTCCCT

TGTCTGTAACCAGGTGTGCTGGCTACTCTTATGTCACCTTGACACACAAACTAGAGCTATCCAAGAGGGAACCTCAATTGAGAAAAATGCTTCCATTATT

TCAGCTTAAGACATTTTCTCAATTAGTGATCACAGGTGGGAGGGCCCATTGTGGATGGGGCCATCCCTGGGCTGGTGGTCCTGGGTTCTATAAGAAAGCA

AGCTGAGGGGCTGGAGAGATGGCTCAGTGGTTAAGAGCACTGACTGACTGGTCCTGAGTTCAATTCCCAGCAACCACATGGTGTCTTATATGTCTCATAA

CCATCTGTAATGGGATAGGATGCCCTCTTCTGGTGTGTCTGAAGACAGCTACAGTGTATTCATATAAAATAAATAAATCTTTAA
Translation
MTANRGAMTFLSVFLLCCWQDVQPWPNRELSG - UNI16132 - GSSGKQWPNLETLDDDIATVFD DEILVRDILEPGKAPYFENQSPSTTSQQKTT

KEKE EVHTKEPIPSKTYQKQSSSGTMHTPSFDD DKQKEILFQLRSLEALEKMIDKIRRAIE ETKLKRRQKLQQSRSSQLLGKPIQP

For any suggestions or comments, please send an email to unitrap@crg.es