Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031537 (Ikbkb)
Chromosomal location
Chr 8: 23769698 - 23817047 (-)
Description
inhibitor of kappaB kinase beta Gene [Source:MGI (curated);Acc:Ikbkb-001]
RefSeq_dna
NM_010546 
RefSeq_peptide
NP_034676.1 
UniGene
Mm.401349 
MGI
MGI:1338071 
Uniprot/SWISSPROT
O88351 
Uniprot/SPTREMBL
Q05DR8 Q3U141 Q3USX8 Q5D0E0 
Human Ortholog
ENSG00000104365 (IKBKB)
Omim not available
UniTrap UNI7385
Vector Insertion
Chr 8: 23774290 - 23775960
Public Clones RRS434 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063401
Sequence
GTTTGAGGAAGTGGCGCTGGGCTGGCTGCGTGGGGACCCCGAGTTTTCATGTCCTCAGCGGGTGTCGCTGGCGGCCCCGCGGCCCCCGGGGCAG AGTTA

GCAGGGCATCGATATGAGCTGGTCACCGTCCCTCCCAACCCAGACATGTGGAGCCTGGGAAATGAAAGAACGCCTGGGGACCGGGGGATTTGGAAACGTC

ATCCGGTGGCACAATCAG GCGACAGGTGAACAGATCGCCATCAAGCAATGCCGACAGGAGCTCAGCCCAAAGAACAGAGACCGCTGGTGCCTCGAAATC

CAGATCATGAGAAG GCTGAACCATCCCAATGTGGTGGCTGCCCGGGATGTCCCAGAGGGGATGCAGAACCTGGCACCCAATGATTTGCCACTGCTGGCC

ATGGAGTACTGCCAAGGAGGAGATCTCCGAAGA TACTTGAACCAGTTCGAGAACTGCTGTGGCCTGCGGGAAGGAGCTGTCCTTACCCTGCTGAGTGAC

ATCG CATCGGCTCTTAGATACCTTCACGAAAACAGAATCATCCATCGAGACCTGAAGCCAGAAAACATCGTTCTGCAGCAAGGAGAGAAAAGA TTAAT

ACACAAAATTATTGATCTAGGATATGCCAAGGAGCTGGATCAGGGCAGTCTGTGCACGTCATTTGTGGGGACTCTGCAATACCTG GCGCCAGAGCTTCT

GGAGCAGCAGAAGTACACCGTGACCGTTGACTACTGGAGCTTCGGCACCCTGGCCTTCGAGTGCATCACTGGCTTCCGGCCCTTCCTCCCTAACTGGCAG

CCTGTGCAGTG GCACTCCAAAGTCCGGCAGAAGAGCGAAGTGGACATCGTTGTTAGTGAAGACTTGAATGGAGCAGTGAAGTTTTCAAGTTCGCTACCC

TTCCCCAATAATCTTAACAG TGTCTTGGCTGAACGGCTGGAGAAGTGGCTGCAGCTGATGCTTATGTGGCACCCTCGGCAAAGGGGCACGGATCCCCAG

TATGGCCCCAACGGCTGCTTCAGAGCCCTGGATGACATCTTGAACTTGAAG CTGGTTCATGTCTTGAACATGGTCACAGGCACCGTTCACACATACCCC

GTGACGGAGGATGAGAGTCTGCAGAGCTTAAAAACCAGAATCCAGGAAGACACGGGGATCCTGGAGACAGACCAGGAGCTGCTGCAAGAGGCAGGGCTGG

TGCTGCTCCCTGACAAGCCTGCTACTCAGTGCATCTCAGACAGCAAG ACAAACGAGGGCCTCACGTTGGACATGGATCTTGTTTTTCTCTTTGACAACA

GTAAAATCAACTATGAGACTCAGATCACCCCCCGACCCCAACCGGAAAGTGTCAGCTGTATCC TTCAGGAGCCCAAGCGGAACCTCTCCTTCTTCCAGC

TGAGGAAAGTGTGGGGCCAAGTCTGGCACAGCATCCAGACGCTGAAGGAAGACTGTAACCGGCTGCAGCAGGGACAGCGAGCAGCCAT GATGAGTCTCC

TCCGGAATAACAGCTGCCTCTCTAAGATGAAGAACGCCATGGCCTCCACGGCCCAGCAGCTCAAGGCCAAGCTGGACTTCTTCAAAACCAGCATCCAGAT

CGACCTGGAGAAGTATAAAGAGCAGACCGAGTTTGGGATCA CCTCAGATAAATTGCTGCTGGCTTGGCGGGAGATGGAGCAGGCTGTGGAGCAGTGTGG

GCGG GAGAATGACGTGAAGCATCTAGTAGAGCGGATGATGGCACTGCAGACTGACATTGTGGACCTGCAGAGGAGCCCGATGGGTCGGAAGCAGGGGGG

CACCCTGGATGACCT AGAGGAACAAGCGAGGGAGCTCTACCGAAGACTCAGGGAGAAGCCAAGAG ACCAAAGGACAGAAGGTGACAGCCAGGAGATGG

TACGGCTGCTGCTTCAGGCAATCCAAAGCTTTGAGAAGAAAGTTCGGGTGATTTATACACAGCTCAG TAAGACCGTGGTTTGTAAGCAGAAGGCACTGG

AGTTGCTGCCCAAGGTAGAAGAGGTAGTGAGCCTTATGAACGAGGACGAGAGGACCGTGGTCCGGCTTCAGGAGAAGCGGCAGAAGGAACTCTGGAACCT

CCTGAAGATCGCCTGT - UNI7385 - AGCAAAGTCCGAGGTCCCGTGAGTGGAAGCCCAGACAGCATGAATGTGTCTCGACTCAGTCACCCTGGTCA

GCTAATGTCCCAGCCTTCCAGTGCCTGTGACAGCTTACCTGAATCAGACAAGAAAAG TGAAGAACTGGTGGCCGAAGCCCACGCCCTCTGCTCCCGGCT

AGAAAGTGCGCTGCAGGACACTGTGAAGGAGCAAGACAGAAGCTTCACGGTAACCGCCTGAGGGAGCCCGGCTTGTCCGTCCCTTCCTCTCTGCAGCAAA

AGTGCAAACGCAGTTTGGCATCAGCCTTGGCTCAGCAGAGACTCATGGTTGGCCCTGCGGTTTTCAGGTTTTTGTATTTATTTCATGCTTAGGACTGCCA

GGTGCATTCATTATCTTAATCCCTTATGACACGTAATCCTAAGGAGGTGACAGCAGTACCAAAAGCCCCTTCTTTCTCTGTGGGACCATTGCAGAACATC

TGTATGTGCTGGGCACTGTGCTGGGCTCTGTGACAAAAGAGAAACCTGTGTGTGTCTCAAGGACTCAGTTTAGCCACAAGCAGTATCAGTGTCAGAGAAA

CTGACCTGAAGGAAATCTAGCCACGATCCAGGCACTTTCAGACAGAGCTTAAACAGTTGTTGGTGTCTAAATGGCCTTTTCCTGCTAATGCAAGCATCCA

CTAACTACTCTTGCATCTAACTTTGGGGAGTCAGAAGAAACCCCATTCAGTTGCCGTCCTCGCTAACCTGCTCACTGGTGAGCCTCCTAACTCCTGCTGC

TTCTCACTTGTCTCCTGGTGCTGTTTCTTCCATCTCACTACTTGCTTGCACTTTAGCCAGAGAAAAGGGCAGCCTTCTGGTTGGCATGGAAACGGATAAC

TGAGATGATTCCCACCTATCTGCAGTGAGTATGTAAATGAGAGCTCTATGCTACAGGCCGTACTAAAATGACCATCCACATTCCACAGGCACAGAGTTCC

AGGAACTTCAGCTAGTCCAAAGGAAATCTGCTGCACATTTGAATCTGTAACTCACTTGGCTCAAGGGTGCCCTGTAGTAGCAGGACTGACGCTGATAAGG

CTTAAACGTACTTCTAGATTGTGTTGCTTGCCTCCTGAAGAGGAACGATGGCCCCGCCACTTGAGTATTTAATGTGCCTGTTGACTTTCAGACTCTAGAC

TGGAGCTGGTTACAGATGGAGGATGAAGAAAGGTGTAGCCTGGAGCAGGCCTGTGACTGAGGTGCCCATGAGCTGGCCCGTGGCTCTGCATGTGACGATG

TTCTGGTATCTCCAGGTGGACATCTCACTCTGCCAGCAGCTGTGATACTTGCCCGCAGCAGCCTAGGCTGGCCCTGTCCACACACTGGATTCTCGCCCAC

AGAAGCACAACAATGCAGGTACAAGCACTTGCAGCAGCGACGCTTCATGGCTGCTGTACAAAGAAAGCGACACAGAGAAATGACAAGTGTCTATCTTGAG

TGTTTCCAGACAGCAGACAGCCTGTCTGCTTTGGACTCCTGGGGGAGGAAGCTCTGCCCTGCCCACCCCTCCTCTCCTTACAGCTGGACGTCATCCGGAT

CCAGCTCTCTTAGACAGTTAATCCTAAGTTTGACTATCCTATATCTCTCTTCCTCTTCACTTCTCCCCTGGTAAATGTTTCAACCTTCTGTGCTGGTCGC

TGTGGCAAACGACCTTTGACTATGCTGTAGTGATGGCGATGCCAAACTCCCTGCTGTTTCTGGTCCTTTAAGCCACAAAGTGACTTACAAAGCCAGGCAG

AACAGAAATGCAGCTACATATCTTGAGTCCCAAAGATTACCTAGAATCAATTGTCACAGAGAAAAAAGGAAGATGAAGGTGTTAT
Translation
 MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQ ATGEQIAIKQCRQELSPKNRDRWCLEIQIMRR RLNHPNVVAARDVPEGMQNLAPNDLPLLAM

EYCQGGDLRR YLNQFENCCGLREGAVLTLLSDIA ASALRYLHENRIIHRDLKPENIVLQQGEKR LIHKIIDLGYAKELDQGSLCTSFVGTLQYL AP

ELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQW WHSKVRQKSEVDIVVSEDLNGAVKFSSSLPFPNNLNS SVLAERLEKWLQLMLMWHPRQ

RGTDPQYGPNGCFRALDDILNLK LVHVLNMVTGTVHTYPVTEDESLQSLKTRIQEDTGILETDQELLQEAGLVLLPDKPATQCISDSK TNEGLTLDMD

LVFLFDNSKINYETQITPRPQPESVSCIL LQEPKRNLSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAM MMSLLRNNSCLSKMKNAMASTAQQLKA

KLDFFKTSIQIDLEKYKEQTEFGIT TSDKLLLAWREMEQAVEQCGR ENDVKHLVERMMALQTDIVDLQRSPMGRKQGGTLDDL LEEQARELYRRLRE

KPRD DQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLS SKTVVCKQKALELLPKVEEVVSLMNEDERTVVRLQEKRQKELWNLLKIAC - UNI7385

 - SKVRGPVSGSPDSMNVSRLSHPGQLMSQPSSACDSLPESDKKS SEELVAEAHALCSRLESALQDTVKEQDRSFTVTA
Transcript ENSMUST00000033939
Sequence
AGGGCAGGAAGTGTTTGAGGAAGTGGCGCTGGGCTGGCTGCGTGGGGACCCCGAGTTTTCATGTCCTCAGCGGGTGTCGCTGGCGGCCCCGCGGCCCCCG

GGGCAG AGTTAGCAGGGCATCGATATGAGCTGGTCACCGTCCCTCCCAACCCAGACATGTGGAGCCTGGGAAATGAAAGAACGCCTGGGGACCGGGGGA

TTTGGAAACGTCATCCGGTGGCACAATCAG GCGACAGGTGAACAGATCGCCATCAAGCAATGCCGACAGGAGCTCAGCCCAAAGAACAGAGACCGCTGG

TGCCTCGAAATCCAGATCATGAGAAG GCTGAACCATCCCAATGTGGTGGCTGCCCGGGATGTCCCAGAGGGGATGCAGAACCTGGCACCCAATGATTTG

CCACTGCTGGCCATGGAGTACTGCCAAGGAGGAGATCTCCGAAGA TACTTGAACCAGTTCGAGAACTGCTGTGGCCTGCGGGAAGGAGCTGTCCTTACC

CTGCTGAGTGACATCG CATCGGCTCTTAGATACCTTCACGAAAACAGAATCATCCATCGAGACCTGAAGCCAGAAAACATCGTTCTGCAGCAAGGAGAG

AAAAGA TTAATACACAAAATTATTGATCTAGGATATGCCAAGGAGCTGGATCAGGGCAGTCTGTGCACGTCATTTGTGGGGACTCTGCAATACCTG GC

GCCAGAGCTTCTGGAGCAGCAGAAGTACACCGTGACCGTTGACTACTGGAGCTTCGGCACCCTGGCCTTCGAGTGCATCACTGGCTTCCGGCCCTTCCTC

CCTAACTGGCAGCCTGTGCAGTG GCACTCCAAAGTCCGGCAGAAGAGCGAAGTGGACATCGTTGTTAGTGAAGACTTGAATGGAGCAGTGAAGTTTTCA

AGTTCGCTACCCTTCCCCAATAATCTTAACAG TGTCTTGGCTGAACGGCTGGAGAAGTGGCTGCAGCTGATGCTTATGTGGCACCCTCGGCAAAGGGGC

ACGGATCCCCAGTATGGCCCCAACGGCTGCTTCAGAGCCCTGGATGACATCTTGAACTTGAAG CTGGTTCATGTCTTGAACATGGTCACAGGCACCGTT

CACACATACCCCGTGACGGAGGATGAGAGTCTGCAGAGCTTAAAAACCAGAATCCAGGAAGACACGGGGATCCTGGAGACAGACCAGGAGCTGCTGCAAG

AGGCAGGGCTGGTGCTGCTCCCTGACAAGCCTGCTACTCAGTGCATCTCAGACAGCAAG ACAAACGAGGGCCTCACGTTGGACATGGATCTTGTTTTTC

TCTTTGACAACAGTAAAATCAACTATGAGACTCAGATCACCCCCCGACCCCAACCGGAAAGTGTCAGCTGTATCC TTCAGGAGCCCAAGCGGAACCTCT

CCTTCTTCCAGCTGAGGAAAGTGTGGGGCCAAGTCTGGCACAGCATCCAGACGCTGAAGGAAGACTGTAACCGGCTGCAGCAGGGACAGCGAGCAGCCAT

 GATGAGTCTCCTCCGGAATAACAGCTGCCTCTCTAAGATGAAGAACGCCATGGCCTCCACGGCCCAGCAGCTCAAGGCCAAGCTGGACTTCTTCAAAAC

CAGCATCCAGATCGACCTGGAGAAGTATAAAGAGCAGACCGAGTTTGGGATCA CCTCAGATAAATTGCTGCTGGCTTGGCGGGAGATGGAGCAGGCTGT

GGAGCAGTGTGGGCGG GAGAATGACGTGAAGCATCTAGTAGAGCGGATGATGGCACTGCAGACTGACATTGTGGACCTGCAGAGGAGCCCGATGGGTCG

GAAGCAGGGGGGCACCCTGGATGACCT AGAGGAACAAGCGAGGGAGCTCTACCGAAGACTCAGGGAGAAGCCAAGAG ACCAAAGGACAGAAGGTGACA

GCCAGGAGATGGTACGGCTGCTGCTTCAGGCAATCCAAAGCTTTGAGAAGAAAGTTCGGGTGATTTATACACAGCTCAG TAAGACCGTGGTTTGTAAGC

AGAAGGCACTGGAGTTGCTGCCCAAGGTAGAAGAGGTAGTGAGCCTTATGAACGAGGACGAGAGGACCGTGGTCCGGCTTCAGGAGAAGCGGCAGAAGGA

ACTCTGGAACCTCCTGAAGATCGCCTGT - UNI7385 - AGCAAAGTCCGAGGTCCCGTGAGTGGAAGCCCAGACAGCATGAATGTGTCTCGACTCAG

TCACCCTGGTCAGCTAATGTCCCAGCCTTCCAGTGCCTGTGACAGCTTACCTGAATCAGACAAGAAAAG TGAAGAACTGGTGGCCGAAGCCCACGCCCT

CTGCTCCCGGCTAGAAAGTGCGCTGCAGGACACTGTGAAGGAGCAAGACAGAAGCTTCACG ACTCTAGACTGGAGCTGGTTACAGATGGAGGATGAAGA

AAGGTGTAGCCTGGAGCAGGCCTGTGACTGAGGTGCCCATGAGCTGGCCCGTGGCTCTGCATGTGACGATGTTCTGGTATCTCCAGGTGGACATCTCACT

CTGCCAGCAGCTGTGATACTTGCCCGCAGCAGCCTAGGCTGGCCCTGTCCACACACTGGATTCTCGCCCACAGAAGCACAACAATGCAGGTACAAGCACT

TGCAGCAGCGACGCTTCATGGCTGCTGTACAAAGAAAGCGACACAGAGAAATGACAAGTGTCTATCTTGAGTGTTTCCAGACAGCAGACAGCCTGTCTGC

TTTGGACTCCTGGGGGAGGAAGCTCTGCCCTGCCCACCCCTCCTCTCCTTACAGCTGGACGTCATCCGGATCCAGCTCTCTTAGACAGTTAATCCTAAGT

TTGACTATCCTATATCTCTCTTCCTCTTCACTTCTCCCCTGGTAAATGTTTCAACCTTCTGTGCTGGTCGCTGTGGCAAACGACCTTTGACTATGCTGTA

GTGATGGCGATGCCAAACTCCCTGCTGTTTCTGGTCCTTTAAGCCACAAAGTGACTTACAAAGCCAGGCAGAACAGAAATGCAGCTACATATCTTGAGTC

CCAAAGATTACCTAGAATCAATTGTCACAGAGAAAAAAGGAAGATGAAGGTGTTATGCCAACTACTACCCTACTGAACACTGCGACTCCTGGGTGCCTGT

CAGGTGTGTGTGGATATTGCTGCCTCTTAAATTAGCTAGCAATATTATTAAATTGGTTCATTTTATAAATAGTTTCTATTTTTTGTAACATTACTCAGAT

ATGTATCCTGGGCTCAAAGGTGTATTTCCATAGTATACCATCACTAGTACTTCTGAGCTCAAAACTCAACATCATGGGAAAGTTTGTAAAATTGAATAGT

GTGTCTATGTCTAGATCATGAGCCATTTTTAACATCACACAAAACTTGTGTGTTTGTGTGCATGTGTGTGTGTAAAAGCAAAAACCGGCTCAGGTTATCA

TAGGCAGGTATATTTAATTAGAGAATACGTAACGCTGGAGCAGAGAAATGTCAGAGTGGCCACCGCAGAGGCAGTATGAAGCATCGACGGTCAAATGAGT

TCAGAGGTGCTGCACGCTTTGATTGTTCCTGAGAGATTGACACTGTGCACTGGTAAACTGTCTGAAAGCTCTGACAATAAAGATGCTGGCTTAAGC
Translation
 MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQ ATGEQIAIKQCRQELSPKNRDRWCLEIQIMRR RLNHPNVVAARDVPEGMQNLAPNDLPLLAM

EYCQGGDLRR YLNQFENCCGLREGAVLTLLSDIA ASALRYLHENRIIHRDLKPENIVLQQGEKR LIHKIIDLGYAKELDQGSLCTSFVGTLQYL AP

ELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQW WHSKVRQKSEVDIVVSEDLNGAVKFSSSLPFPNNLNS SVLAERLEKWLQLMLMWHPRQ

RGTDPQYGPNGCFRALDDILNLK LVHVLNMVTGTVHTYPVTEDESLQSLKTRIQEDTGILETDQELLQEAGLVLLPDKPATQCISDSK TNEGLTLDMD

LVFLFDNSKINYETQITPRPQPESVSCIL LQEPKRNLSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAM MMSLLRNNSCLSKMKNAMASTAQQLKA

KLDFFKTSIQIDLEKYKEQTEFGIT TSDKLLLAWREMEQAVEQCGR ENDVKHLVERMMALQTDIVDLQRSPMGRKQGGTLDDL LEEQARELYRRLRE

KPRD DQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLS SKTVVCKQKALELLPKVEEVVSLMNEDERTVVRLQEKRQKELWNLLKIAC - UNI7385

 - SKVRGPVSGSPDSMNVSRLSHPGQLMSQPSSACDSLPESDKKS SEELVAEAHALCSRLESALQDTVKEQDRSFT TLDWSWLQMEDEERCSLEQAC

D

For any suggestions or comments, please send an email to unitrap@crg.es