Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031540 (Myst3)
Chromosomal location
Chr 8: 23970007 - 24053734 (+)
Description
MYST histone acetyltransferase (monocytic leukemia) 3 Gene [Source:MGI (curated);Acc:Myst3-002]
RefSeq_dna
NM_001081149 
RefSeq_peptide
NP_001074618.1 
UniGene
Mm.457502 Mm.182776 
MGI
MGI:2442415 
Uniprot/SWISSPROT
Q8BZ21 
Uniprot/SPTREMBL
A0PJC5 Q3UFW4 Q3UPM9 Q3V1G6 Q8C6L0 
Human Ortholog
ENSG00000083168 (MYST3)
Omim not available
UniTrap UNI7170
Vector Insertion
Chr 8: 23972075 - 23972359
Public Clones RRU419 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36029
Vector Insertion
Chr 8: 23972075 - 23972359
Public Clones IST10070G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23438
Vector Insertion
Chr 8: 23972359 - 23973274
Public Clones not available
Private Clones OST259778 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8222
Vector Insertion
Chr 8: 24043187 - 24045951
Public Clones RRI103 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110696
Sequence
AGTCGGAGCTCACTGTCTCCAAGATGGCGGCCGTGTCAGTTTGGGGCATCTCCGCGGTCCGGCCCGGGCCCCCGGGATCCCGGCTGTCTTCCCCCCAG -

 UNI7170 - - UNI23438 - - UNI36029 - GCTTAAGATACTCACTTTCTGCTTGAAGCCGGGAATGAGATGTGTGGAACCCAGGAGTGTGTG

TGGAGTAGACACCAATGCGTTGTGATAGTGAGGATTTTGAAGATACGACAGAAAAACCAGGCGTTTTGATTTCTGAGGTAAAAGTAGGCTGTAAATCTAT

TTTGTGAAAGGAGGGAAGACTCAGGCCAGAAATCTTGTATGCTATGGTTAACTGGTTCCCATCCTCCGAGAATCCTGTTTTCCATGGTGTAAGACTTACT

CAGCATCAGGATAAGGGATAACGACTCTATGGATATACAGAATCCTTCACCATGGTAAAACTCGCTAACCCGCTGTACACGGAGTGGATTTTGGAGGCCA

TCAAAAAAGTCAAGAAGCAGAAACAGCGACCTTCAGAGGAAAGGATCTGCAATGCCGTGTCCTCATCCCATGGGCTGGACCGCAGGACTGTGCTAGAGCA

GCTGGAGCTGAGCGTCAAAGACGGGACGATTTTAAAGGTCTCAAACAAAGGTCTCAATTCCTACAAAGATCCTGATAATCCTGGGCGAATAGCACTTCCT

AAACCTCGGAACCATGGAAAATTGGATACTAAGCAAAGTGTGGATTGGAATAAATTACTCAAGCGGGCATTTGAGGGCTTGGCAGAGACTGGTGGCTCAA

CTTTGAAAAGTATCGAACGTTTTTTGAAAAGCCAGAAGGATGTATCTGCTGCCTGTGGAGGTAGTGCTGCCCCTGGGTTTCACCAGCAGCTACGATTGGC

CATCAAGCGTGCTGTTGGTCATGGCCGACTCCTCAAAGATGGACCCCTCTACCGCCTCAACACTAAGGCAGCCAGTGCTGAAGGGAAAGAGGGCTGTGAG

TCGCTCTCGTGTTTACCTCCCGTGTCACTGCTTCCACACGAGAAAGACAAG - UNI23438 - CCGGTTGCTGAACCAATCCCCATCTGTAGCTTCTG

TCTTGGTACAAAAGAGCAGAACCGGGAGAAGCAGCCCGAGGAACTCGTCTCCTGCGCGGACTGCGGCAATAGCG GTCATCCATCGTGTTTAAAGTTCTC

CCCAGAGCTAACAGTGAGAGTGAAGGCCTTACGGTGGCAGTGCATTGAGTGTAAAACATGCAGCTCCTGTCGTGACCAAGGCAAAAACGCA GATAACAT

GCTCTTTTGTGACTCATGTGACCGAGGTTTTCACATGGAGTGTTGTGACCCACCACTTACACGGATGCCAAAAG GTATGTGGATATGTCAGATATGCCG

ACCTAGGAAAAAAGGACGGAAACTTCTACAAAAGAAGGCGGCACAGATAAAACGGCGCTATGCTAATCCAATAGGACGTCCAAAAAACAGGTTAAAGAAA

CAAAACACGGT ATCAAAAGGTCCCTTTAGCAAAGTTCGAACTGGTCCTGGAAGGGGTCGGAAACGTAAAATCACTGTCTCCAGCCAGTCTGCATCATCA

TCAGAAGAAGGCTATTTAGAGCGGATAGATGGCTTGGACTTCTGCAGAGATAGCAATGCCCCCTTGAAGTTCAACAAGAAAACCAAAGGGCTCATTGATG

GCCTTACCAAATTCTTCACCCCTTCTCCTGATGGGCGGAAAGCCCGAGGGGAAGTGGTAGACTACTCTGAGCAATACAGAATCAGGAAAAAGGGCAACAG

GAAATCAAGTACTTCAGATTGGCCCACAG ACAATCAGGACGGCTGGGAAAGCAAACAAGAAAATGAGGAACGGCTTTTTGGGAGCCAAGAAATCATGAC

TGAAAGAGATATGGAATTGTTTCGTGATATCCAAGAACAAGCACTGCAG AAGGTCGGAGTAACTGGGCCCCCTGATCCACAAGTCCGCTGTCCCTCTGT

CATTGAGTTTGGGAAGTATGAAATCCACACCTGGTATTCCTCTCCGTACCCTCAGGAGTACTCAAG GCTGCCTAAATTGTATCTTTGTGAGTTCTGTCT

AAAATATATGAAAAGTAGAACTATTCTACAGCAGCACATGAAGAAATGTGGTTGGTTCCATCCTCCTGCCAATGAGATTTACCGAAAGAATAATATTTCT

GTCTTTGAG GTTGATGGGAACGTGAGTACCATTTATTGTCAAAATCTGTGTCTCTTGGCAAAGTTGTTTCTTGACCACAAAACACTCTATTATGACGTG

GAGCCATTTCTTTTCTATGTTCTAACACAGAATGATGTCAAGGGCTGCCACCTTGTTGGCTACTTTTCTAAA GAAAAGCACTGCCAACAGAAATACAAT

GTCTCCTGTATAATGATTCTTCCCCAATACCAACGTAAGGGCTACGGCAGGTTTCTCATCGATTTCA GTTATTTGTTATCAAAGCGTGAAGGCCAAGCA

GGCTCTCCTGAGAAACCATTATCAGATCTAGGTCGTCTCTCCTACATGGCTTACTGGAAGAGTGTGATCCTGGAGTGCCTTTATCACCAAAATGACAAGC

AGATCAGCATCAAGAAGCTGAGCAAGCTGACTGGAGTCTGCCCTCAGGACATCACGTCCACACTGCACCACCTACGAATGCTGGACTTCCGCAGTGACCA

 ATTTGTGATTATCCGCCGGGAGAAACTTATCCAGGATCACATGGCAAAGCTGCAGCTGAACCTTCGGCCTGTAGATGTAGATCCAGAGTGCTTACGCTG

GACTCCAGTCATAGTCTCCAATTCTGTGGTCTCCGAGGATGAAGACGAGGAGGCCGATGAGGGAGAGAAAGAAGAGCCCCAAGGCCAAGAAAGAGAGCTA

GAGACCAGGGTAAAG GTGGGGAAGTCTGTGTCTCGGGAGAAAAAAGATCAGGAGTCTTCCTCTTTAATAGAAACTGACAAGAAGCCAGAAGTTAAGGAA

CTAGCCAGTTCTTCACGTTTGAGCAAACAGGCCCTTCCTCGGGACAGTCTTCCTGCAAATAGCCAGCCACCTCGGAGGGGCCGCTGTGGGAGGAAGAACA

GAAAGACACAAGAACGCTTTGGTGATAAAGATTCTAAGATGCTTGTGGATGAGACACTATCCGCTTCTCAAGAGCAATATGGAGACTGCGAGGAAAAGTC

AGAAACCTCCCAAGAACGGTTCACTGAGATGGAAGAGCAGTTGGCAGCCCCTCAAGTGCAAGCAGACGGGAAACCAGACATCCCCAAGGGGAGGTTCAGT

GAGAGCGTTGAGTTGTGGCGAGGACAGCTGAAGAAAAGCCCTGAGACCCTGAAGTGCCGATTGCCAGAAGGAAATGACCGGCTTCCGTGCTGCTACACCG

ATGGTGACAGGGCTGTCTTTAGGGGCTTCAGCGAGAGCAGTGAGGAGGAGGAAGAGCCAGAGAGTCCCCGGTCAAACTCGCCACCAATTCTCACGAAGCC

CACACTGAAAAGAAAG - UNI8222 - AAACCGATTCTTCACCGAAGACGAAGAGTCCGCAAGCGGAAACACCACAATAGCAGTGTAGTCACAGAGAC

CATCTCTGAGACCACGGAGGTGTTAGATGAGCCTTTTGAAGACTCTGACTCTGAGAGACCAATGCCACGACTGGAGCCTACATTTGAGATGGAGGAAGAG

GAGGAGGAGGAGGAGGAGGAGAGTGAGCTCTTCCCCAGAGGGTACTTCCATTGCCTGTCCTCACAGGACATCCTTAGGTGTCAGTCCTCCTCCAAGAGGC

CGTCTAAAGAGGAAGAGGAGGAGGAGGAGGAGTCAGACGACGCAGATG ACACTCCTGTCCTAAAGCCAGTATCTCTCTTGCGAAAATGTGATGTGAACA

GTGCTTCACTTGAGCCAGATACCTCTACACCTATGAAAAAGAAAAAGGGATGGCCCAAAGGCAAGAGCCGAAAACCTATCCACTGGAAGAAAAGGCCTGG

ACGGAAACCAGGATTTAAATTGAATCAGGAAATCATAGCTGCTTCTGCACAGGAATGCATAGTTGAGCCCGTAGTCCCCATTAAACCAGGCCGTAAACCC

AGAACTCAAGAGAATGAAGAAATTGTTGAGGTAAAGGAGGACTTGCTGGAAGAAAGGAAAGAAGAGATGCACACAGAACCAGATGAGGAGGCCGAAGAGG

AAGAGGATACAACCAGCAGTGACATTAGAGCCATGTCCCCATTGGACAGCAGCAACAGCCCTGAGGCAGAACCAAAAGAACCCGAGCCAGAGGAGGAAGA

CGAGAAGCCTTCGGACGATCAGAGGCAGTCAGAGGAAGAGCCCCAAGAGCTGGAGGAGCAGGAGCAGGAGGAAGAAGATGAAGTGACCACAGAGGCCAAC

CAGAACGAAGACCATGACGCTGACGATGAGGACGAAGGCCACCTGGATTCGCTAAAGACAAAAGAGCCAGAGGAGCAGCCAGCTAGAGAAGACGACAAGG

AGGAGCCTGGCATCCAGGGATCTTTTTTAGCTGCAAACATGCAGGACAGTAGGGAGAATACAAAGGATAAAGATGAGGCTGAACCGGATTCTGAGGAAGA

CCAGCCTTCCCATGAGGCTTCTGTGGTATCAGAAACCATGCCAGGCTCAGAGGAGGACCATGAGGAAGACTCCAACACTAAGGAAGAGTTAATTGAGCTA

AAGGAGGAGGAAGAGATCCCACACAGCGAACTGGACCTGGAGACTGTACAGGCAGTGCAATCTTTGACTCAAGAAGAAAGCAGTGAGCATGAAGGAGCCT

ACCAGGACTGTGAAGAAACTCTTGCAGCCTGCCAGACACTGCAGAGTTACACCCACACTGATGAGGACCCCCAGATGTCAATGGTTGAAGACTGTCATGC

TTCAGAGCATAATAGCCCGATATCCTCCATTCCGTCTCATCCTAGCCAGTCAGTCCGCTCTGTCAACAGCCCCAGCATGCCTGCCCTGGAGAGTGGCTAC

ACACAGATCAGCCCAGAGCAAGGATCCCTGTCCGCACCCTCTATGCAGAACATGGAGACCAGCCCCATGATGGATGTGCCTTCCGTATCAGACCACTCTC

AGCAGGTGGTAGACAGCGGCTTCAGTGATCTGGGCAGCATCGAGAGTACCACAGAGAACTATGAGAACCCAAGCAGCTATGATTCCACCATGGGCAGCAG

CATTTGTGGGAATAATTCCTCTCAGAGCAGCTGCTCGTATGGCGGCCTGTCGTCTTCAAGCAGCCTCACCCAGAACAGTTGTGTTGTTACTCAGCAAATG

GCCAACATGGGCAACAGCTGCAGCATGCTGCAACAGAACACTGTCCAACCAGCCGCCAACTGCAATATCAAGTCACCGCAGACTTGTGTGGTGGAAAGGC

CTCCCAGTAACCAGCAGCCACCCCCGCCACCACCCCCGCCGCCACCACCACAGCAGCCGCAGCCGCCGCCACAGCAACAGGCGGCCCCACAGCCTCCCCC

ACCACAGCCGCAGCAGCAGCAGCAGCAACAGCAGCAGCCCCCTCCACCACAGCAGCAGCCCCAGCCCCCTCCACCACAGCAGCAGCCCCCTCTGTCTCAG

TGCAGTATGAACAACAGCTTCACTGCAGCCCCCATGATAATGGAGATACCCGAGTCTGGAAGCACTGGGAATATCAGTATCTACGAGAGGATTCCAGGGG

ATTTTGGTGCAGGCAGCTACTCCCAACCATCAGCCACCTTCAGTCTAGCCAAGCTGCAGCAGCTGACCAACACCATCATGGACCCTCATGCCATGCCTTA

CAGTCATTCTCCGGCTGTGACTTCCTATGCAACCAGTGTTTCTCTGTCCAACACGGGACTGGCTCAGCTAGCTCCATCTCATCCCTTAGCCGGGACCCCT

CAAGCACAAGCCACCATGACTCCACCCCCAAATCTGGCGTCTACTACTATGAACCTCACGTCACCTCTGCTACAGTGCAACATGTCTGCCACCAACATCG

GAATTCCTCACACTCAGAGGTTGCAAGGGCAGATGCCAGTCAAGGGGCACATTTCTATCCGTTCCAAGTCTGCACCTTTACCCTCTGCAACTGCACACCA

ACAGCAGCTATATGGCCGCAGCCCACCAGCAGTTGCCATGCAGGCTGGCCCTCGTGCATTGGCTGTTCAGCGTGGCATGAACATGGGGGTTAATTTAATG

CCCACTCCAGCCTATAATGTCAATTCCATGAATATGAACACCTTGAATGCCATGAACAGTTATCGAATGACACAGCCCATGATGAACAGCAGTTACCATA

GTAACCCTGCCTACATGAACCAGACAGCACAGTATCCTATGCAGATGCAGATGGGGATGATGGGAAGCCAGGCCTATACCCAGCAGCCTATGCAGCCAAA

CCCTCACGGGAACATGATGTACACTGGCCCCTCCCATCACAGCTACATGAATGCTGCTGGCGTGCCCAAGCAGTCACTTAACGGACCTTACATGAGGAGA

TGAGCGAGGTGGACCGGCAGTCAGAAGCTTAAATATATATAAATAAAGGAACTTTTTATACTGACAAACCAGAGAAAAAAATGGACCTTTTTTCCAATTA

AAATATTACTGTAGAGTTAGAGGAGTTTTTCTTTGGTTTATTATTATTACTGTTTTTGTTTTGTTTTTAGAAAACCTGATCTCTTTTTGGGGGTTCAACT

TTGTTTTGGGTTTTTGTTTTCTTCACAGTCTTGAACATTTTACAGTAGAACTCATCTAAAGATGGATTTGGGTAGGGAAACATGCACAGAATCTTTTCAT

AATTAAAAGGAGCCTTACTTTCTTTATATACCACATGGACAGAAGTTATGTCAACGTGAATTTATTTTTATTTTACAATGTATGTTTCCCCTCACTGTCT

GCAGCTCCCGCTGTTGTCATTTTAAATGTTATATATACATCTCAAGGGTCACCCAGGCCCTGTCCTCCAGACCCAACCTTCATTTCCCACTTCATTCCAA

CAGGAGGCACTTAGGGGAACTGGGATGGGGACGTGGAGAACAACCCAAGCTCCTTAAACTTAATGTTGTTGTTGTTATTATTCATAAAGTGAAGCAGGTA

ATGTTTCTCCTTGTAAAATTCCCTCCCCTCCTCCCTGTGTGTGCGCGCACACACACACACACACACACACACACCCCCTCTGGAAACTTTTCCCCAAGAG

TGTTTCTAGGTAGACTTCATTGAAATTGTTTTTCCTTAATCAAGTATAATATAATTCTTTTTTTTTTAAAATATTCCCACTCAGCACTCAGAGACACAAA

AATACTGTAAGTCTCACTTAACAGCAGAATCTCAGAGGAAAGCTGTTTGCAATCCTACTCCAGCCTTTGGAGGACTCAGAGGGTCAGCTAACAATCAGAA

AGGGGAGGTGTACCTCTTGGTCTGTACCACCTGGTGGACCAGCCATAACATGCACACTCCACTCGCCTCTGTAGTATGTACTTGGAAATGTGGACTAAGG

GTCTTGTGCTTGCACCTTTGACTCTGGTAACCCTCAGAGCAAGCCCCTGTGATTTGCCTGTCATATCTTATCCAGTCTCCACGAACGACTGTAGTGTCAG

TGACTTAGAAAACCCCTGGTGCAGACGGAGTCCCAAGGGAGATGATGGTGTGACTCTTGTAGCTGCAGAAGTGATGCATACCTCTCGTTTTCATTTTGTC

TTGAGATCCTGAATTCACCCCCAAGAACCAGTGTGCACTAGCCCCTCTCCTGTGAGGATGAGCAAGGAGAGACCCACCACCAGCATAGTAGGGCACAGCT

GGCAGTAGGGCTTCAGGAGGCTCACATGTTGTCTCACTAGTTTGCCCGTTCTCTTCCTACTCGCTCCAGGGATAGGTAAAAAACTATATATATAATTATA

ATTATATATATATATTATATATTCCATCATTAGAAGATGGAAACTATTATACCAGTTGGTATGTGCAGTCAAATATCCAAAAGGAGGACATAATGCTTAA

AAAATTACCTGTAAGCATAAATTCTCTCCTTTATTTGTACATTTTATATAGATAAATTTTTAAAGTACTAATTAGGCATTACATTTTTTTCAAATGCACA

GGTTTGTTGGGCTTTTTTATAGACCTTAATTGGCTTTCTCAATTAAGTGTGTTAGCTAGAAAAGCAGAATTCCACACTGTCCCGCTATCAACTCTGAGCA

TGCGCAAGGCTGCGTAGGACCCAGTTTCTCTGTATATACTGTTCCGGTTCCCAGTCATCTCTGTAGAATGTGCACCGTGCTGCCCTCTCCCACATCTTCA

GCTATGTCATTGCTTCCTGGATGGGATGGGGCAGGGATGGGAGGGAGGGAAGGGAGGTCTATTTGGGAGGAGGGTGGGTCAAGGCAGAAGGAGACGCTGT

TGAAATGAGGGCCGTGAATTCACTTTCTGTTGGTTTGCAGTTGTGTTTGGGTTTCTTTGTTTTGTTTTGTTTTTAAATTCAATCAGGCAGCTCCCTTTTC

TGCAAGCCTCTTTGTGACTGTAGAACTATTGTAGAAAAAAAAATATGTTCTTTTCTATATTATAAAAGAAAATTATCCAACACGGTAATATTGGTACCTG

TCATTTTTTCACTTCTGTTTTAAAAAAATGTATTTTTAGCAAGATAACTTGGGTAATCTTCTAAAAAAGAAATTTAAAAACTCACTTGTTAGTGACTTTG

ATGCCTTTTAAAATGAGAGCTTTTTCATTTCATTCCATCTTTAAAATTTTTTATCTTTGTTGTAGAATATTAAAAACTATTTTAAGAAAGATAAAAATTC

TCTTTAAAGAGATGTCTAGAGTGTGTGAATAGAGCCCCAGATGCCTCTAAAAGCCGCATGTACAAACCGAGTCTACTCCCGTCTGTTTATATTTGCTTTC

CTGTTTTGTAACCTCTTTGTACTCTGTTCCTGGTGACTTGTAAGCCGAGGGGAGGGGCACCTAGACGCCTTGGTGTTTCTCCATGTCATACGCTCCTGGC

CAGGCAGCCCCCCTCCCTCTCCTTGTATGTAATATCTTTTCCCCCTTTCTAGCAAGTACTTTCAAAAGAACTCTGTACATTTTAACATAAAAAAAATAAA

TTATGTTGAGCCATTTTGGA
Translation
 - UNI7170 - - UNI23438 - - UNI36029 - MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRRTVLEQLELSVKDGTIL

KVSNKGLNSYKDPDNPGRIALPKPRNHGKLDTKQSVDWNKLLKRAFEGLAETGGSTLKSIERFLKSQKDVSAACGGSAAPGFHQQLRLAIKRAVGHGRLL

KDGPLYRLNTKAASAEGKEGCESLSCLPPVSLLPHEKDK - UNI23438 - PVAEPIPICSFCLGTKEQNREKQPEELVSCADCGNSG GHPSCLKFS

PELTVRVKALRWQCIECKTCSSCRDQGKNA DNMLFCDSCDRGFHMECCDPPLTRMPKG GMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRL

KKQNTV VSKGPFSKVRTGPGRGRKRKITVSSQSASSSEEGYLERIDGLDFCRDSNAPLKFNKKTKGLIDGLTKFFTPSPDGRKARGEVVDYSEQYRIRK

KGNRKSSTSDWPTD DNQDGWESKQENEERLFGSQEIMTERDMELFRDIQEQALQ KVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSR RLPK

LYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFE VDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSK 

EKHCQQKYNVSCIMILPQYQRKGYGRFLIDFS SYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGVCPQDITSTLH

HLRMLDFRSDQ QFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIVSNSVVSEDEDEEADEGEKEEPQGQERELETRVK VGKSVSREKKDQESS

SLIETDKKPEVKELASSSRLSKQALPRDSLPANSQPPRRGRCGRKNRKTQERFGDKDSKMLVDETLSASQEQYGDCEEKSETSQERFTEMEEQLAAPQVQ

ADGKPDIPKGRFSESVELWRGQLKKSPETLKCRLPEGNDRLPCCYTDGDRAVFRGFSESSEEEEEPESPRSNSPPILTKPTLKRK - UNI8222 - KP

ILHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEMEEEEEEEEEESELFPRGYFHCLSSQDILRCQSSSKRPSKEEEEEEEES

DDADD DTPVLKPVSLLRKCDVNSASLEPDTSTPMKKKKGWPKGKSRKPIHWKKRPGRKPGFKLNQEIIAASAQECIVEPVVPIKPGRKPRTQENEEIVE

VKEDLLEERKEEMHTEPDEEAEEEEDTTSSDIRAMSPLDSSNSPEAEPKEPEPEEEDEKPSDDQRQSEEEPQELEEQEQEEEDEVTTEANQNEDHDADDE

DEGHLDSLKTKEPEEQPAREDDKEEPGIQGSFLAANMQDSRENTKDKDEAEPDSEEDQPSHEASVVSETMPGSEEDHEEDSNTKEELIELKEEEEIPHSE

LDLETVQAVQSLTQEESSEHEGAYQDCEETLAACQTLQSYTHTDEDPQMSMVEDCHASEHNSPISSIPSHPSQSVRSVNSPSMPALESGYTQISPEQGSL

SAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGSSICGNNSSQSSCSYGGLSSSSSLTQNSCVVTQQMANMGNSCSML

QQNTVQPAANCNIKSPQTCVVERPPSNQQPPPPPPPPPPPQQPQPPPQQQAAPQPPPPQPQQQQQQQQQPPPPQQQPQPPPPQQQPPLSQCSMNNSFTAA

PMIMEIPESGSTGNISIYERIPGDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPPP

NLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSATAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSM

NMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGPYMRR
Transcript ENSMUST00000044331
Sequence
GGAGCTCACTGTCTCCAAGATGGCGGCCGTGTCAGTTTGGGGCATCTCCGCGGTCCGGCCCGGGCCCCCGGGATCCCGGCTGTCTTCCCCCCAG GATTC

TTCCTACTAATCCAGATACTTGTTGAAGTGCTGAATAGTTTCTTGGGGACAATGTGGAGGACGAGTTGACCCCCTAGACTG - UNI7170 - - UNI2

3438 - - UNI36029 - GCTTAAGATACTCACTTTCTGCTTGAAGCCGGGAATGAGATGTGTGGAACCCAGGAGTGTGTGTGGAGTAGACACCAATG

CGTTGTGATAGTGAGGATTTTGAAGATACGACAGAAAAACCAGGCGTTTTGATTTCTGAGGTAAAAGTAGGCTGTAAATCTATTTTGTGAAAGGAGGGAA

GACTCAGGCCAGAAATCTTGTATGCTATGGTTAACTGGTTCCCATCCTCCGAGAATCCTGTTTTCCATGGTGTAAGACTTACTCAGCATCAGGATAAGGG

ATAACGACTCTATGGATATACAGAATCCTTCACCATGGTAAAACTCGCTAACCCGCTGTACACGGAGTGGATTTTGGAGGCCATCAAAAAAGTCAAGAAG

CAGAAACAGCGACCTTCAGAGGAAAGGATCTGCAATGCCGTGTCCTCATCCCATGGGCTGGACCGCAGGACTGTGCTAGAGCAGCTGGAGCTGAGCGTCA

AAGACGGGACGATTTTAAAGGTCTCAAACAAAGGTCTCAATTCCTACAAAGATCCTGATAATCCTGGGCGAATAGCACTTCCTAAACCTCGGAACCATGG

AAAATTGGATACTAAGCAAAGTGTGGATTGGAATAAATTACTCAAGCGGGCATTTGAGGGCTTGGCAGAGACTGGTGGCTCAACTTTGAAAAGTATCGAA

CGTTTTTTGAAAAGCCAGAAGGATGTATCTGCTGCCTGTGGAGGTAGTGCTGCCCCTGGGTTTCACCAGCAGCTACGATTGGCCATCAAGCGTGCTGTTG

GTCATGGCCGACTCCTCAAAGATGGACCCCTCTACCGCCTCAACACTAAGGCAGCCAGTGCTGAAGGGAAAGAGGGCTGTGAGTCGCTCTCGTGTTTACC

TCCCGTGTCACTGCTTCCACACGAGAAAGACAAG - UNI23438 - CCGGTTGCTGAACCAATCCCCATCTGTAGCTTCTGTCTTGGTACAAAAGAGC

AGAACCGGGAGAAGCAGCCCGAGGAACTCGTCTCCTGCGCGGACTGCGGCAATAGCG GTCATCCATCGTGTTTAAAGTTCTCCCCAGAGCTAACAGTGA

GAGTGAAGGCCTTACGGTGGCAGTGCATTGAGTGTAAAACATGCAGCTCCTGTCGTGACCAAGGCAAAAACGCA GATAACATGCTCTTTTGTGACTCAT

GTGACCGAGGTTTTCACATGGAGTGTTGTGACCCACCACTTACACGGATGCCAAAAG GTATGTGGATATGTCAGATATGCCGACCTAGGAAAAAAGGAC

GGAAACTTCTACAAAAGAAGGCGGCACAGATAAAACGGCGCTATGCTAATCCAATAGGACGTCCAAAAAACAGGTTAAAGAAACAAAACACGGT ATCAA

AAGGTCCCTTTAGCAAAGTTCGAACTGGTCCTGGAAGGGGTCGGAAACGTAAAATCACTGTCTCCAGCCAGTCTGCATCATCATCAGAAGAAGGCTATTT

AGAGCGGATAGATGGCTTGGACTTCTGCAGAGATAGCAATGCCCCCTTGAAGTTCAACAAGAAAACCAAAGGGCTCATTGATGGCCTTACCAAATTCTTC

ACCCCTTCTCCTGATGGGCGGAAAGCCCGAGGGGAAGTGGTAGACTACTCTGAGCAATACAGAATCAGGAAAAAGGGCAACAGGAAATCAAGTACTTCAG

ATTGGCCCACAG ACAATCAGGACGGCTGGGAAAGCAAACAAGAAAATGAGGAACGGCTTTTTGGGAGCCAAGAAATCATGACTGAAAGAGATATGGAAT

TGTTTCGTGATATCCAAGAACAAGCACTGCAG AAGGTCGGAGTAACTGGGCCCCCTGATCCACAAGTCCGCTGTCCCTCTGTCATTGAGTTTGGGAAGT

ATGAAATCCACACCTGGTATTCCTCTCCGTACCCTCAGGAGTACTCAAG GCTGCCTAAATTGTATCTTTGTGAGTTCTGTCTAAAATATATGAAAAGTA

GAACTATTCTACAGCAGCACATGAAGAAATGTGGTTGGTTCCATCCTCCTGCCAATGAGATTTACCGAAAGAATAATATTTCTGTCTTTGAG GTTGATG

GGAACGTGAGTACCATTTATTGTCAAAATCTGTGTCTCTTGGCAAAGTTGTTTCTTGACCACAAAACACTCTATTATGACGTGGAGCCATTTCTTTTCTA

TGTTCTAACACAGAATGATGTCAAGGGCTGCCACCTTGTTGGCTACTTTTCTAAA GAAAAGCACTGCCAACAGAAATACAATGTCTCCTGTATAATGAT

TCTTCCCCAATACCAACGTAAGGGCTACGGCAGGTTTCTCATCGATTTCA GTTATTTGTTATCAAAGCGTGAAGGCCAAGCAGGCTCTCCTGAGAAACC

ATTATCAGATCTAGGTCGTCTCTCCTACATGGCTTACTGGAAGAGTGTGATCCTGGAGTGCCTTTATCACCAAAATGACAAGCAGATCAGCATCAAGAAG

CTGAGCAAGCTGACTGGAGTCTGCCCTCAGGACATCACGTCCACACTGCACCACCTACGAATGCTGGACTTCCGCAGTGACCA ATTTGTGATTATCCGC

CGGGAGAAACTTATCCAGGATCACATGGCAAAGCTGCAGCTGAACCTTCGGCCTGTAGATGTAGATCCAGAGTGCTTACGCTGGACTCCAGTCATAGTCT

CCAATTCTGTGGTCTCCGAGGATGAAGACGAGGAGGCCGATGAGGGAGAGAAAGAAGAGCCCCAAGGCCAAGAAAGAGAGCTAGAGACCAGGGTAAAG G

TGGGGAAGTCTGTGTCTCGGGAGAAAAAAGATCAGGAGTCTTCCTCTTTAATAGAAACTGACAAGAAGCCAGAAGTTAAGGAACTAGCCAGTTCTTCACG

TTTGAGCAAACAGGCCCTTCCTCGGGACAGTCTTCCTGCAAATAGCCAGCCACCTCGGAGGGGCCGCTGTGGGAGGAAGAACAGAAAGACACAAGAACGC

TTTGGTGATAAAGATTCTAAGATGCTTGTGGATGAGACACTATCCGCTTCTCAAGAGCAATATGGAGACTGCGAGGAAAAGTCAGAAACCTCCCAAGAAC

GGTTCACTGAGATGGAAGAGCAGTTGGCAGCCCCTCAAGTGCAAGCAGACGGGAAACCAGACATCCCCAAGGGGAGGTTCAGTGAGAGCGTTGAGTTGTG

GCGAGGACAGCTGAAGAAAAGCCCTGAGACCCTGAAGTGCCGATTGCCAGAAGGAAATGACCGGCTTCCGTGCTGCTACACCGATGGTGACAGGGCTGTC

TTTAGGGGCTTCAGCGAGAGCAGTGAGGAGGAGGAAGAGCCAGAGAGTCCCCGGTCAAACTCGCCACCAATTCTCACGAAGCCCACACTGAAAAGAAAG 

- UNI8222 - AAACCGATTCTTCACCGAAGACGAAGAGTCCGCAAGCGGAAACACCACAATAGCAGTGTAGTCACAGAGACCATCTCTGAGACCACGG

AGGTGTTAGATGAGCCTTTTGAAGACTCTGACTCTGAGAGACCAATGCCACGACTGGAGCCTACATTTGAGATGGAGGAAGAGGAGGAGGAGGAGGAGGA

GGAGAGTGAGCTCTTCCCCAGAGGGTACTTCCATTGCCTGTCCTCACAGGACATCCTTAGGTGTCAGTCCTCCTCCAAGAGGCCGTCTAAAGAGGAAGAG

GAGGAGGAGGAGGAGTCAGACGACGCAGATG ACACTCCTGTCCTAAAGCCAGTATCTCTCTTGCGAAAATGTGATGTGAACAGTGCTTCACTTGAGCCA

GATACCTCTACACCTATGAAAAAGAAAAAGGGATGGCCCAAAGGCAAGAGCCGAAAACCTATCCACTGGAAGAAAAGGCCTGGACGGAAACCAGGATTTA

AATTGAATCAGGAAATCATAGCTGCTTCTGCACAGGAATGCATAGTTGAGCCCGTAGTCCCCATTAAACCAGGCCGTAAACCCAGAACTCAAGAGAATGA

AGAAATTGTTGAGGTAAAGGAGGACTTGCTGGAAGAAAGGAAAGAAGAGATGCACACAGAACCAGATGAGGAGGCCGAAGAGGAAGAGGATACAACCAGC

AGTGACATTAGAGCCATGTCCCCATTGGACAGCAGCAACAGCCCTGAGGCAGAACCAAAAGAACCCGAGCCAGAGGAGGAAGACGAGAAGCCTTCGGACG

ATCAGAGGCAGTCAGAGGAAGAGCCCCAAGAGCTGGAGGAGCAGGAGCAGGAGGAAGAAGATGAAGTGACCACAGAGGCCAACCAGAACGAAGACCATGA

CGCTGACGATGAGGACGAAGGCCACCTGGATTCGCTAAAGACAAAAGAGCCAGAGGAGCAGCCAGCTAGAGAAGACGACAAGGAGGAGCCTGGCATCCAG

GGATCTTTTTTAGCTGCAAACATGCAGGACAGTAGGGAGAATACAAAGGATAAAGATGAGGCTGAACCGGATTCTGAGGAAGACCAGCCTTCCCATGAGG

CTTCTGTGGTATCAGAAACCATGCCAGGCTCAGAGGAGGACCATGAGGAAGACTCCAACACTAAGGAAGAGTTAATTGAGCTAAAGGAGGAGGAAGAGAT

CCCACACAGCGAACTGGACCTGGAGACTGTACAGGCAGTGCAATCTTTGACTCAAGAAGAAAGCAGTGAGCATGAAGGAGCCTACCAGGACTGTGAAGAA

ACTCTTGCAGCCTGCCAGACACTGCAGAGTTACACCCACACTGATGAGGACCCCCAGATGTCAATGGTTGAAGACTGTCATGCTTCAGAGCATAATAGCC

CGATATCCTCCATTCCGTCTCATCCTAGCCAGTCAGTCCGCTCTGTCAACAGCCCCAGCATGCCTGCCCTGGAGAGTGGCTACACACAGATCAGCCCAGA

GCAAGGATCCCTGTCCGCACCCTCTATGCAGAACATGGAGACCAGCCCCATGATGGATGTGCCTTCCGTATCAGACCACTCTCAGCAGGTGGTAGACAGC

GGCTTCAGTGATCTGGGCAGCATCGAGAGTACCACAGAGAACTATGAGAACCCAAGCAGCTATGATTCCACCATGGGCAGCAGCATTTGTGGGAATAATT

CCTCTCAGAGCAGCTGCTCGTATGGCGGCCTGTCGTCTTCAAGCAGCCTCACCCAGAACAGTTGTGTTGTTACTCAGCAAATGGCCAACATGGGCAACAG

CTGCAGCATGCTGCAACAGAACACTGTCCAACCAGCCGCCAACTGCAATATCAAGTCACCGCAGACTTGTGTGGTGGAAAGGCCTCCCAGTAACCAGCAG

CCACCCCCGCCACCACCCCCGCCGCCACCACCACAGCAGCCGCAGCCGCCGCCACAGCAACAGGCGGCCCCACAGCCTCCCCCACCACAGCCGCAGCAGC

AGCAGCAGCAACAGCAGCAGCCCCCTCCACCACAGCAGCAGCCCCAGCCCCCTCCACCACAGCAGCAGCCCCCTCTGTCTCAGTGCAGTATGAACAACAG

CTTCACTGCAGCCCCCATGATAATGGAGATACCCGAGTCTGGAAGCACTGGGAATATCAGTATCTACGAGAGGATTCCAGGGGATTTTGGTGCAGGCAGC

TACTCCCAACCATCAGCCACCTTCAGTCTAGCCAAGCTGCAGCAGCTGACCAACACCATCATGGACCCTCATGCCATGCCTTACAGTCATTCTCCGGCTG

TGACTTCCTATGCAACCAGTGTTTCTCTGTCCAACACGGGACTGGCTCAGCTAGCTCCATCTCATCCCTTAGCCGGGACCCCTCAAGCACAAGCCACCAT

GACTCCACCCCCAAATCTGGCGTCTACTACTATGAACCTCACGTCACCTCTGCTACAGTGCAACATGTCTGCCACCAACATCGGAATTCCTCACACTCAG

AGGTTGCAAGGGCAGATGCCAGTCAAGGGGCACATTTCTATCCGTTCCAAGTCTGCACCTTTACCCTCTGCAACTGCACACCAACAGCAGCTATATGGCC

GCAGCCCACCAGCAGTTGCCATGCAGGCTGGCCCTCGTGCATTGGCTGTTCAGCGTGGCATGAACATGGGGGTTAATTTAATGCCCACTCCAGCCTATAA

TGTCAATTCCATGAATATGAACACCTTGAATGCCATGAACAGTTATCGAATGACACAGCCCATGATGAACAGCAGTTACCATAGTAACCCTGCCTACATG

AACCAGACAGCACAGTATCCTATGCAGATGCAGATGGGGATGATGGGAAGCCAGGCCTATACCCAGCAGCCTATGCAGCCAAACCCTCACGGGAACATGA

TGTACACTGGCCCCTCCCATCACAGCTACATGAATGCTGCTGGCGTGCCCAAGCAGTCACTTAACGGACCTTACATGAGGAGATGAGCGAGGTGGACCGG

CAGTCAGAAGCTTAAATATATATAAATAAAGGAACTTTTTATACTGACAAACCAGAGAAAAAAATGGACCTTTTTTCCAATTAAAATATTACTGTAGAGT

TAGAGGAGTTTTTCTTTGGTTTATTATTATTACTGTTTTTGTTTTGTTTTTAGAAAACCTGATCTCTTTTTGGGGGTTCAACTTTGTTTTGGGTTTTTGT

TTTCTTCACAGTCTTGAACATTTTACAGTAGAACTCATCTAAAGATGGATTTGGGTAGGGAAACATGCACAGAATCTTTTCATAATTAAAAGGAGCCTTA

CTTTCTTTATATACCACATGGACAGAAGTTATGTCAACGTGAATTTATTTTTATTTTACAATGTATGTTTCCCCTCACTGTCTGCAGCTCCCGCTGTTGT

CATTTTAAATGTTATATATACATCTCAAGGGTCACCCAGGCCCTGTCCTCCAGACCCAACCTTCATTTCCCACTTCATTCCAACAGGAGGCACTTAGGGG

AACTGGGATGGGGACGTGGAGAACAACCCAAGCTCCTTAAACTTAATGTTGTTGTTGTTATTATTCATAAAGTGAAGCAGGTAATGTTTCTCCTTGTAAA

ATTCCCTCCCCTCCTCCCTGTGTGTGCGCGCACACACACACACACACACACACACACCCCCTCTGGAAACTTTTCCCCAAGAGTGTTTCTAGGTAGACTT

CATTGAAATTGTTTTTCCTTAATCAAGTATAATATAATTCTTTTTTTTTTAAAATATTCCCACTCAGCACTCAGAGACACAAAAATACTGTAAGTCTCAC

TTAACAGCAGAATCTCAGAGGAAAGCTGTTTGCAATCCTACTCCAGCCTTTGGAGGACTCAGAGGGTCAGCTAACAATCAGAAAGGGGAGGTGTACCTCT

TGGTCTGTACCACCTGGTGGACCAGCCATAACATGCACACTCCACTCGCCTCTGTAGTATGTACTTGGAAATGTGGACTAAGGGTCTTGTGCTTGCACCT

TTGACTCTGGTAACCCTCAGAGCAAGCCCCTGTGATTTGCCTGTCATATCTTATCCAGTCTCCACGAACGACTGTAGTGTCAGTGACTTAGAAAACCCCT

GGTGCAGACGGAGTCCCAAGGGAGATGATGGTGTGACTCTTGTAGCTGCAGAAGTGATGCATACCTCTCGTTTTCATTTTGTCTTGAGATCCTGAATTCA

CCCCCAAGAACCAGTGTGCACTAGCCCCTCTCCTGTGAGGATGAGCAAGGAGAGACCCACCACCAGCATAGTAGGGCACAGCTGGCAGTAGGGCTTCAGG

AGGCTCACATGTTGTCTCACTAGTTTGCCCGTTCTCTTCCTACTCGCTCCAGGGATAGGTAAAAAACTATATATATAATTATAATTATATATATATATTA

TATATTCCATCATTAGAAGATGGAAACTATTATACCAGTTGGTATGTGCAGTCAAATATCCAAAAGGAGGACATAATGCTTAAAAAATTACCTGTAAGCA

TAAATTCTCTCCTTTATTTGTACATTTTATATAGATAAATTTTTAAAGTACTAATTAGGCATTACATTTTTTTCAAATGCACAGGTTTGTTGGGCTTTTT

TATAGACCTTAATTGGCTTTCTCAATTAAGTGTGTTAGCTAGAAAAGCAGAATTCCACACTGTCCCGCTATCAACTCTGAGCATGCGCAAGGCTGCGTAG

GACCCAGTTTCTCTGTATATACTGTTCCGGTTCCCAGTCATCTCTGTAGAATGTGCACCGTGCTGCCCTCTCCCACATCTTCAGCTATGTCATTGCTTCC

TGGATGGGATGGGGCAGGGATGGGAGGGAGGGAAGGGAGGTCTATTTGGGAGGAGGGTGGGTCAAGGCAGAAGGAGACGCTGTTGAAATGAGGGCCGTGA

ATTCACTTTCTGTTGGTTTGCAGTTGTGTTTGGGTTTCTTTGTTTTGTTTTGTTTTTAAATTCAATCAGGCAGCTCCCTTTTCTGCAAGCCTCTTTGTGA

CTGTAGAACTATTGTAGAAAAAAAAATATGTTCTTTTCTATATTATAAAAGAAAATTATCCAACACGGTAATATTGGTACCTGTCATTTTTTCACTTCTG

TTTTAAAAAAATGTATTTTTAGCAAGATAACTTGGGTAATCTTCTAAAAAAGAAATTTAAAAACTCACTTGTTAGTGACTTTGATGCCTTTTAAAATGAG

AGCTTTTTCATTTCATTCCATCTTTAAAATTTTTTATCTTTGTTGTAGAATATTAAAAACTATTTTAAGAAAGATAAAAATTCTCTTTAAAGAGATGTCT

AGAGTGTGTGAATAGAGCCCCAGATGCCTCTAAAAGCCGCATGTACAAACCGAGTCTACTCCCGTCTGTTTATATTTGCTTTCCTGTTTTGTAACCTCTT

TGTACTCTGTTCCTGGTGACTTGTAAGCCGAGGGGAGGGGCACCTAGACGCCTTGGTGTTTCTCCATGTCATACGCTCCTGGCCAGGCAGCCCCCCTCCC

TCTCCTTGTATGTAATATCTTTTCCCCCTTTCTAGCAAGTACTTTCAAAAGAACTCTGTACATTTTAACATAAAAAAAATAAATTATGTTGAGCCATTTT

GGATGT
Translation
  - UNI7170 - - UNI23438 - - UNI36029 - MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRRTVLEQLELSVKDGTI

LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDTKQSVDWNKLLKRAFEGLAETGGSTLKSIERFLKSQKDVSAACGGSAAPGFHQQLRLAIKRAVGHGRL

LKDGPLYRLNTKAASAEGKEGCESLSCLPPVSLLPHEKDK - UNI23438 - PVAEPIPICSFCLGTKEQNREKQPEELVSCADCGNSG GHPSCLKF

SPELTVRVKALRWQCIECKTCSSCRDQGKNA DNMLFCDSCDRGFHMECCDPPLTRMPKG GMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNR

LKKQNTV VSKGPFSKVRTGPGRGRKRKITVSSQSASSSEEGYLERIDGLDFCRDSNAPLKFNKKTKGLIDGLTKFFTPSPDGRKARGEVVDYSEQYRIR

KKGNRKSSTSDWPTD DNQDGWESKQENEERLFGSQEIMTERDMELFRDIQEQALQ KVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSR RLP

KLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFE VDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSK

 EKHCQQKYNVSCIMILPQYQRKGYGRFLIDFS SYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGVCPQDITSTL

HHLRMLDFRSDQ QFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIVSNSVVSEDEDEEADEGEKEEPQGQERELETRVK VGKSVSREKKDQES

SSLIETDKKPEVKELASSSRLSKQALPRDSLPANSQPPRRGRCGRKNRKTQERFGDKDSKMLVDETLSASQEQYGDCEEKSETSQERFTEMEEQLAAPQV

QADGKPDIPKGRFSESVELWRGQLKKSPETLKCRLPEGNDRLPCCYTDGDRAVFRGFSESSEEEEEPESPRSNSPPILTKPTLKRK - UNI8222 - K

PILHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEMEEEEEEEEEESELFPRGYFHCLSSQDILRCQSSSKRPSKEEEEEEEE

SDDADD DTPVLKPVSLLRKCDVNSASLEPDTSTPMKKKKGWPKGKSRKPIHWKKRPGRKPGFKLNQEIIAASAQECIVEPVVPIKPGRKPRTQENEEIV

EVKEDLLEERKEEMHTEPDEEAEEEEDTTSSDIRAMSPLDSSNSPEAEPKEPEPEEEDEKPSDDQRQSEEEPQELEEQEQEEEDEVTTEANQNEDHDADD

EDEGHLDSLKTKEPEEQPAREDDKEEPGIQGSFLAANMQDSRENTKDKDEAEPDSEEDQPSHEASVVSETMPGSEEDHEEDSNTKEELIELKEEEEIPHS

ELDLETVQAVQSLTQEESSEHEGAYQDCEETLAACQTLQSYTHTDEDPQMSMVEDCHASEHNSPISSIPSHPSQSVRSVNSPSMPALESGYTQISPEQGS

LSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGSSICGNNSSQSSCSYGGLSSSSSLTQNSCVVTQQMANMGNSCSM

LQQNTVQPAANCNIKSPQTCVVERPPSNQQPPPPPPPPPPPQQPQPPPQQQAAPQPPPPQPQQQQQQQQQPPPPQQQPQPPPPQQQPPLSQCSMNNSFTA

APMIMEIPESGSTGNISIYERIPGDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPP

PNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSATAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNS

MNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGPYMRR

For any suggestions or comments, please send an email to unitrap@crg.es