Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031545 (Agpat6)
Chromosomal location
Chr 8: 24284207 - 24318833 (-)
Description
1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) Gene [Source:MGI Symbol;Acc:MGI:2142716]
RefSeq_dna
NM_018743 
RefSeq_peptide
NP_061213.2 
UniGene
Mm.200898 
MGI
MGI:2142716 
Uniprot/SWISSPROT
Q8K2C8 
Uniprot/SPTREMBL
O35259 Q3TIF6 Q3TSI4 Q5QHR4 Q6PEU9 
Human Ortholog
ENSG00000158669 (AGPAT6)
Omim not available
UniTrap UNI4971
Vector Insertion
Chr 8: 24302165 - 24318770
Public Clones XS0453 (sanger) D103B03 (ggtc) IST14967B10 (tigm)
Private Clones OST438012 (lexicon) OST268945 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10190
Vector Insertion
Chr 8: 24295071 - 24301187
Public Clones DTM030 (baygenomics) (ggtc) IST14634A10 (tigm)
Private Clones OST406382 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26686
Vector Insertion
Chr 8: 24293436 - 24295000
Public Clones not available
Private Clones OST103559 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37795
Vector Insertion
Chr 8: 24285979 - 24289973
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033949
Sequence
GGCGGCGGGCAGGGCAGGGCGGGAGCGGCAGTCACCGAGGACTGGAGCCGAGCCTCACGGCCG - UNI4971 - CTCTGGCAGCATGTAAACAGCCTT

TTGCCAAGAACCCAGGTCACCGCTGAGAAGGCTGCCTTAAGGGAGAAGAATATCGGAGGACACCAATGCCAGGCGTGTTTGGAACAGTGCTCAGTACAGG

CAGCATGAGACGTTCTGTGCCAGCCTCTGTGTGCTACTGGCAAAGGCTGGGGCTCTCTGGGTAGGAGGGTCCTGGGTCAGCCAGCATCAGGAGCCCCCTC

AAGGGAGCATGGGACCAGCTATGAACTCTTTACAGTGAACTCAGTTTTAGCTTATGAAGGAATTTTAAGTAAACGTTACTTAATTTCTACATACTGACGT

TTGGCAGCCTTGGGTGTGAAGTGCCAGCAGCTACCCTTGTCTACTGGAGTTTCAGGATTCTTCTGGCACCAAGGCGAACTCTTCTTGGTACTTCTGACAA

TACAGATCTTTAGGACAAATTTACCCGCTGAATGCTTTGGGGCAGGAGGAAAGTAAAACCTTGGAAGCAGCCACATAGCTGAACAGAAAGCTGCCCCTTG

CCGCTCGCTTGCCCGGACACTCAGGACTCAGGTGCTGTTCCAGCCTACTCACCACAGATTGTCATCTGTGCCCGGGAGACCTGGCATTTCTGGGGTGCTC

CTGTGACCCTTCTGCAGTTCTGCGCCAGAGCTCTATTCAGGCAGTTGGATGACATGAACTTTGAGATGGAGTTTGTCACCCGTGAGGGACTGGCTGCCTT

TCCAAGGCTTGTGCTATCTGAAGGGACCATCTGAAGGACGTGTTTGTGTGTGGAAAAGAGGGCACCAGCCTGACGTGCGTCCTCCACCATGTTCCTGTTG

CTACCTTTTGATAGCTTGATTGTCAACCTCCTGGGTATCTCCCTGACCGTCCTCTTCACCCTGCTGCTTGTTTTCATCATCGTCCCTGCCATCTTTGGAG

TGTCCTTTGGTATCCGAAAGCTCTACATGAAAACACTGCTAAAGATCTTTGCG - UNI10190 - TGGGCCACCCTGAGAATGGAGAGAGGAGCCAAG

GAGAGGAACCACCAGCTGTACAAGCCCTACACCAACG - UNI26686 - GAATCATTGCAAAAGATCCCACTTCTCTGGAAGAAGAAATCAAAGAAAT

TCGTCGAAGTGGTAGTAGTAAAGCTCTGGATAAGACACCCGAGTTCGAGCTCTCTGACATCTTCTACTTTTGCCGGAAAGGAATGGAGACTATCATGGAT

GATGAAGTGACAAAGAGATTCTCGGCAGAGGAGCTGGAGTCCTGGAACTTGCTGAGCAGAACCAATTACAACTTCCAATACATAAGCCTGCGGCTTACCA

TCCTCTGGGGCTTAGGAGTGCTGATTCGGTATTGCTTCCTCCTGCCACTCAG GATTGCGCTGGCATTCACGGGGATTGGCCTCTTGGTAGTGGGAACTA

CTATGGTTGGATACCTGCCAAATGGGAG ATTTAAGGAGTTTTTGAGTAAACACGTTCACTTAATGTGCTACCGTATCTGTGTGCGAGCCCTGACGGCCA

TCATTACGTACCACAACAG GAAAAACAGACCAAGAAATGGTGGCATCTGTGTGGCTAACCATACATCCCCCATTGATGTGATCATCTTGGCCAGCGACG

GCTACTACGCCATG GTGGGACAGGTTCACGGGGGCCTTATGGGTGTGATTCAGAGAGCAATGGTGAAAGCCTGCCCCCATGTCTGGTTTGAGCGTTCTG

AGGTGAAAGATCGCCACCTGGTGGCTAAGAG GCTGACTGAGCATGTCCAGGATAAAAGCAAGCTGCCCATCCTCATCTTCCCAGAAG - UNI37795 

- GAACCTGCATCAATAACACATCAGTGATGATGTTCAAGAAGGGAAGCTTTGAAATTGGAGCCACTGTTTACCCTGTGGCTATCAAG - UNI37795 

- TATGACCCTCAGTTTGGTGACGCCTTCTGGAACAGCAGCAAGTATGGCATGGTGACGTACCTTCTGAGGATGATGACCAGTTGGGCCATTGTCTGCAG

CGTTTGGTACCTGCCTCCTATGACTCGAGAG - UNI37795 - AAAGATGAAGATGCTGTGCAGTTTGCTAACAGAGTGAAGTCTGCCATTGCCCGGC

AGGGAGGATTGGTAGACCTGCTGTG GGACGGTGGATTGAAGAGAGAAAAGGTGAAGGACACATTCAAGGAGGAGCAGCAGAAGCTATATAGCAAGATGA

TAGTCGGAAACCATGAGGACCGCAGCCGGTCCTGAGCCTCCGTCTTGTGCTGGCTGAAGCCGCCACCTCTAAATCCTGAAGTGTGAGCCAGCTGCAGTTG

TTGCTGCCACAGCCTCTACCGTCATCCCCGCCACCCACTGCTGCATCCTTCCGGACTCTGGCCCTCAGGCTGTTCTGGACTCCAGGACTGGAGCTGCGTC

AGAGCTCCGTGGGCTGCCTGCTGTCCTCTAACCAGAATGCTTCTGGCTGGGGCTCCCTGGGACAAAATGCCTCTTGTTCTTATAGTAAGCCTCTAAGAGG

AATGCCATTAAAGCAGTTCTAGCTGGTGAAAAGGTGGGCCCTGTTCTTGCCCTGAGAGGATGTTAGGTGTTTCTGTAGAAACAGCCATATGCTGGTAAAG

TCGGAAAAGACACTGCAGAGGCCGGTGCCTAAACAGCCTCCAGCTTAGCGCTTGAGATGTGGCAGAAAGGACTGTCTGCAGGAGTGCTCACGTCCTCCAG

CGAGTGGAGTCCTAAGTCCCTGTGTTCCTGCTTATGAAGATCACCAGAGGAGATAGGAAGAGCCAGTGGGCTCCTGGGCAGTTAGCTAGCCCCAGGCTGA

GCCTGAATCCCCCACATGACTTGTTTAATATGTCTCAGTTTCCCTGTCTGTTCCATGGAATTGCGGAGAGAGATGGTGGTGTGCCTACCTCACAGGGTTG

TTGTGGGGATTCCAGTGCTAGTGCGTGTGAAGGAAATGTGTGCTGCTCTCCCAGGGACAGCTTCAGAGAGCGTGGCAGGACAAGGTCAGAGCTACAGCTG

CTGCCCAGGATTTTAAAATTGTTTGTGAGTAAATAAAACTGGATGGTAAATG
Translation
 - UNI4971 - MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFGVSFGIRKLYMKTLLKIFA - UNI10190 - WATLRMERGAKERNHQLY

KPYTNG - UNI26686 - GIIAKDPTSLEEEIKEIRRSGSSKALDKTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISL

RLTILWGLGVLIRYCFLLPLR RIALAFTGIGLLVVGTTMVGYLPNGR RFKEFLSKHVHLMCYRICVRALTAIITYHNR RKNRPRNGGICVANHTSPI

DVIILASDGYYAM VGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVAKR RLTEHVQDKSKLPILIFPEG - UNI37795 - GTCINNTSVMMF

KKGSFEIGATVYPVAIK - UNI37795 - YDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTRE - UNI37795 - KDEDAVQFANRV

KSAIARQGGLVDLLW WDGGLKREKVKDTFKEEQQKLYSKMIVGNHEDRSRS

For any suggestions or comments, please send an email to unitrap@crg.es