Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031554 (Adam5)
Chromosomal location
Chr 8: 25837830 - 25934841 (-)
Description
a disintegrin and metallopeptidase domain 5 Gene [Source:MGI (curated);Acc:Adam5-001]
RefSeq_peptide
NP_031427.2 
UniGene
Mm.143889 
MGI
MGI:104730 
Uniprot/SWISSPROT
Q3TTE0 
Uniprot/SPTREMBL
Q78E93 
Human Ortholog
ENSG00000196115 (ADAM5P)
Omim not available
UniTrap UNI28539
Vector Insertion
Chr 8: 25837903 - 25843456
Public Clones not available
Private Clones OST28500 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110653
Sequence
AATTCTGGGGACAGTACGCCGAAGTATCCTGGAAGATGCGTGGCTGCCGTCAGTAACCTGAATATTTTCGGATATCTTTTCCTCAGTGATGTGTAAATTT

TTTTTAAAAGACATGATAAATGATACAAAGAAAATCCTTACCAGCTCTTCCTAGCCTGAAGAGTAAACCTGCAGGCATCCACCTTCCTTTTTACAGTTAG

CAGGATGGTTGGTACCTGAATCTATGCATCTATCTCGTTCTCCAGCCCTTTCTGCTCTGGTTTCCCTAGCGACAACCCTGCAGGTTCAGGGCCCAGAGCT

TCCGTTACTGGACACAACGCCCGCCCCGCCCAGCCTGTTGCTCCGCAGCAAAGCTCCAAGACCACCAAGGGAGCCATGTTCCTCCTTCTTTTGCTCTTTT

TGCATCTTAAAGGGCTGCAGGCAGGCCAGA ATCCTCAGAAAACCACCCTGCAGACAACTGTTCCTGAAAAGATCTCATCACCGGATGTGGAAACAGATG

CAGAAGACCAT ATGGCTTATCTTATTACAATAAATGAAACCCCCCATTTCATCCATCTTAAAAAACA ATCATTTATAACTCCAACTGCAGTTGTTTAT

ACTTACGACAGAAATGATGTTCAACATTCTCAACCTTTGTCAGCTCTG GAAAATTGCAATTACAATGGATATGTTGCAGGTTTCCCAAACTCTATCGTG

ACCCTCACCGTTTGCACAGGACTCAG GGGAATCATACAGTTTGAAAATGTCTCCTATGCAATCGAGCCCGTGGAAACCCTGTCAGGATTTGTGCACGTG

ATCTATGAGAACACAAACAAACATGCTGTGATTCCTGACCTGGGAAAGAATCAGTCATACAGTTGGTTTGACGAATCAGATTATCAATTCCGGAGTAACA

TGAAG AAATCTGGATTTACCGTGTTACGCCAACGATTCATTATGATGGATATCATCGTGGATAAAAAGCTG TTTGATTACATGGGTTCTGACACTGAA

GTTGTGCTACAGAAAGTCATTCAGATCATCGGTTTCGTTAACACT ATGCTCTCCAAGTTAAAACTGACTGTCTTAATAAATTCCATTGAAATCTGGTCG

AAGGAAAACAGAATTCGTTTATCAAAGGCAGTTGATGACTTATTGGTTCAGTTCTCAATTTGGAAACATGAGTATAGATCACAACATGTTGCATACTTAC

TGGC ATTTGAGGAGCACCCTGCTTCCACGGGGGCTCTATATCCAGGGAATCTGTGCAAACTGGAGTACAATGCTGCTGTTGCCCTG TATCCAAAAGGT

TTATCGTTAGAATCGTTTAGTGTCATTGTCCTGCAGCTGCTGAGCATTGGTATGGGCTTAACTTACGACACTGAGAACTGCCACTGTACAGGAGAAGTTT

GCCTAATGACGCCCAAAGCAAT ATATTCTGGGGGTGTGAAGGACTTCAGTACTTGTACCCTGGATGACTTTAAATACCTGTCAACAAGACAAGACCTTA

GATGTCTCCAGGACTTGCCTTTGGAAAGAAAGCCAGCTCGCAGGCCAAGGAGAATCTGTGGCAATGGGATACTGGAGATGAACGAGCAATGTGACTGTGG

CACTTTGAAG AACTGTACACATAGAAAATGCTGTGACCCTATGTCATGTCGATTGAAAAACAAGGCCACGTGTGGTTCTGGGGAGTGCTGTAGTCAAGA

TTGCACG GTAAAAATGAATGATGTGGTCTGTAGAAAGTCGGTAGATGAATGTGACTTTGTGGAGTACTGTAACGGAAAAGATCCCTATTGTGTCCCTAA

CACATATGCACGCAATGGGCAGTATTGTGAATCAGGTGAAGCCTTCTGTTTTGAAGGACGATGTCAGACTGCTGACAAGCAATGTATGAGCATGCTTGGG

AAAT ACGTGAGAGGGGCTTCCTTTGCGTGCTATGAAGAGTTCAATTCCAGAGGCGATAGATTTGGCAACTGTATTCATAATTTTTGTGCTTTCAG AAA

TTCTCTCTGTGGGAAACTAATCTGTACGTGGCCATTCAAGAAGCTGGTGCTAAAAGCCAATTTATCTGTGGCCTATGCGCAAATCCGGGATGACTTGTGT

GTAGCTATGTATAAAGGTGGGAGGATACCTAAGACAACAAAGACGACATATTCCAATCCAGCGGACAGAGATGAGACATTTGTAAACGACGGCACCATCT

GTGGCCCTGATATG TTTTGTTTGAGAGCATCATGCACAGAAACTAGATTTCACATGGATTCTTCCAAGTGTGATTCAACTAGAGATTGCAACGACCATG

GG GTTTGCAACAATTTACAGCATTGCCACTGTGATATAGGATATAACCCTCCTTTTTGTGAGGAACATAAGGGACAGTTTGGAAGCGTTGATGATGGAC

ATAAATATCATGTTGAAG ATGGTAAAAGCTATAAGCAGCAAAGTCATAGTAATCTTAAAAAAAATCAGCTTCAGCTCATTCTCTACATATCTCTGCCCT

TACTTGTGATGATTTCAGCTGTAGTTATAAAGCAAAGCAAACTGAGTCGTGTATGTGACAGAGAAAGAAGTGAAAGCGACAG CTCTACAACAGAAGATA

GCGGGAGTAACACCAATGTGACCAGCAGTGGAGGAAG GACTGCTGAA
Translation
MFLLLLLFLHLKGLQAGQN NPQKTTLQTTVPEKISSPDVETDAEDH MAYLITINETPHFIHLKKQ QSFITPTAVVYTYDRNDVQHSQPLSAL ENCN

YNGYVAGFPNSIVTLTVCTGLR RGIIQFENVSYAIEPVETLSGFVHVIYENTNKHAVIPDLGKNQSYSWFDESDYQFRSNMK KSGFTVLRQRFIMMDI

IVDKKL FDYMGSDTEVVLQKVIQIIGFVNT MLSKLKLTVLINSIEIWSKENRIRLSKAVDDLLVQFSIWKHEYRSQHVAYLLA AFEEHPASTGALYP

GNLCKLEYNAAVAL YPKGLSLESFSVIVLQLLSIGMGLTYDTENCHCTGEVCLMTPKAI IYSGGVKDFSTCTLDDFKYLSTRQDLRCLQDLPLERKPA

RRPRRICGNGILEMNEQCDCGTLK NCTHRKCCDPMSCRLKNKATCGSGECCSQDCT VKMNDVVCRKSVDECDFVEYCNGKDPYCVPNTYARNGQYCES

GEAFCFEGRCQTADKQCMSMLGKY YVRGASFACYEEFNSRGDRFGNCIHNFCAFR RNSLCGKLICTWPFKKLVLKANLSVAYAQIRDDLCVAMYKGGR

IPKTTKTTYSNPADRDETFVNDGTICGPDM FCLRASCTETRFHMDSSKCDSTRDCNDHG VCNNLQHCHCDIGYNPPFCEEHKGQFGSVDDGHKYHVED

 DGKSYKQQSHSNLKKNQLQLILYISLPLLVMISAVVIKQSKLSRVCDRERSESDS SSTTEDSGSNTNVTSSGGR RTAE
Transcript ENSMUST00000118419
Sequence
AATTCTGGGGACAGTACGCCGAAGTATCCTGGAAGATGCGTGGCTGCCGTCAGTAACCTGAATATTTTCGGATATCTTTTCCTCAGTGATGTGTAAATTT

TTTTTAAAAGACATGATAAATGATACAAAGAAAATCCTTACCAGCTCTTCCTAGCCTGAAGAGTAAACCTGCAGGCATCCACCTTCCTTTTTACAGTTAG

CAGGATGGTTGGTACCTGAATCTATGCATCTATCTCGTTCTCCAGCCCTTTCTGCTCTGGTTTCCCTAGCGACAACCCTGCAGGTTCAGGGCCCAGAGCT

TCCGTTACTGGACACAACGCCCGCCCCGCCCAGCCTGTTGCTCCGCAGCAAAGCTCCAAGACCACCAAGGGAGCCATGTTCCTCCTTCTTTTGCTCTTTT

TGCATCTTAAAGGGCTGCAGGCAGGCCAGA ATCCTCAGAAAACCACCCTGCAGACAACTGTTCCTGAAAAGATCTCATCACCGGATGTGGAAACAGATG

CAGAAGACCAT ATGGCTTATCTTATTACAATAAATGAAACCCCCCATTTCATCCATCTTAAAAAACA ATCATTTATAACTCCAACTGCAGTTGTTTAT

ACTTACGACAGAAATGATGTTCAACATTCTCAACCTTTGTCAGCTCTG GAAAATTGCAATTACAATGGATATGTTGCAGGTTTCCCAAACTCTATCGTG

ACCCTCACCGTTTGCACAGGACTCAG GGGAATCATACAGTTTGAAAATGTCTCCTATGCAATCGAGCCCGTGGAAACCCTGTCAGGATTTGTGCACGTG

ATCTATGAGAACACAAACAAACATGCTGTGATTCCTGACCTGGGAAAGAATCAGTCATACAGTTGGTTTGACGAATCAGATTATCAATTCCGGAGTAACA

TGAAG AAATCTGGATTTACCGTGTTACGCCAACGATTCATTATGATGGATATCATCGTGGATAAAAAGCTG TTTGATTACATGGGTTCTGACACTGAA

GTTGTGCTACAGAAAGTCATTCAGATCATCGGTTTCGTTAACACT ATGCTCTCCAAGTTAAAACTGACTGTCTTAATAAATTCCATTGAAATCTGGTCG

AAGGAAAACAGAATTCGTTTATCAAAGGCAGTTGATGACTTATTGGTTCAGTTCTCAATTTGGAAACATGAGTATAGATCACAACATGTTGCATACTTAC

TGGC ATTTGAGGAGCACCCTGCTTCCACGGGGGCTCTATATCCAGGGAATCTGTGCAAACTGGAGTACAATGCTGCTGTTGCCCTG TATCCAAAAGGT

TTATCGTTAGAATCGTTTAGTGTCATTGTCCTGCAGCTGCTGAGCATTGGTATGGGCTTAACTTACGACACTGAGAACTGCCACTGTACAGGAGAAGTTT

GCCTAATGACGCCCAAAGCAAT ATATTCTGGGGGTGTGAAGGACTTCAGTACTTGTACCCTGGATGACTTTAAATACCTGTCAACAAGACAAGACCTTA

GATGTCTCCAGGACTTGCCTTTGGAAAGAAAGCCAGCTCGCAGGCCAAGGAGAATCTGTGGCAATGGGATACTGGAGATGAACGAGCAATGTGACTGTGG

CACTTTGAAG AACTGTACACATAGAAAATGCTGTGACCCTATGTCATGTCGATTGAAAAACAAGGCCACGTGTGGTTCTGGGGAGTGCTGTAGTCAAGA

TTGCACG GTAAAAATGAATGATGTGGTCTGTAGAAAGTCGGTAGATGAATGTGACTTTGTGGAGTACTGTAACGGAAAAGATCCCTATTGTGTCCCTAA

CACATATGCACGCAATGGGCAGTATTGTGAATCAGGTGAAGCCTTCTGTTTTGAAGGACGATGTCAGACTGCTGACAAGCAATGTATGAGCATGCTTGGG

AAAT ACGTGAGAGGGGCTTCCTTTGCGTGCTATGAAGAGTTCAATTCCAGAGGCGATAGATTTGGCAACTGTATTCATAATTTTTGTGCTTTCAG AAA

TTCTCTCTGTGGGAAACTAATCTGTACGTGGCCATTCAAGAAGCTGGTGCTAAAAGCCAATTTATCTGTGGCCTATGCGCAAATCCGGGATGACTTGTGT

GTAGCTATGTATAAAGGTGGGAGGATACCTAAGACAACAAAGACGACATATTCCAATCCAGCGGACAGAGATGAGACATTTGTAAACGACGGCACCATCT

GTGGCCCTGATATG TTTTGTTTGAGAGCATCATGCACAGAAACTAGATTTCACATGGATTCTTCCAAGTGTGATTCAACTAGAGATTGCAACGACCATG

GG GTTTGCAACAATTTACAGCATTGCCACTGTGATATAGGATATAACCCTCCTTTTTGTGAGGAACATAAGGGACAGTTTGGAAGCGTTGATGATGGAC

ATAAATATCATGTTGAAG ATGGTAAAAGCTATAAGCAGCAAAGTCATAGTAATCTTAAAAAAAATCAGCTTCAGCTCATTCTCTACATATCTCTGCCCT

TACTTGTGATGATTTCAGCTGTAGTTATAAAGCAAAGCAAACTGAGTCGTGTATGTGACAGAGAAAGAAGTGAAAGCGACAG CTCTACAACAGAAGATA

GCGGGAGTAACACCAATGTGACCAGCAGTGGAGGAAG CACCTCCCACTAATCAAGTATTGCTACCCCAAAAGAAGATAATCTGGATTAACCATGAGAAA

CTGACATTCTGAGCAAGAAGATGGAAAACACCAAACCAAAACAACCCAACCCACAGCTTCTCTCCCACTCTAAACCATGAACTAATAAATCAGCTATGAC

TGAACAAATGC
Translation
MFLLLLLFLHLKGLQAGQN NPQKTTLQTTVPEKISSPDVETDAEDH MAYLITINETPHFIHLKKQ QSFITPTAVVYTYDRNDVQHSQPLSAL ENCN

YNGYVAGFPNSIVTLTVCTGLR RGIIQFENVSYAIEPVETLSGFVHVIYENTNKHAVIPDLGKNQSYSWFDESDYQFRSNMK KSGFTVLRQRFIMMDI

IVDKKL FDYMGSDTEVVLQKVIQIIGFVNT MLSKLKLTVLINSIEIWSKENRIRLSKAVDDLLVQFSIWKHEYRSQHVAYLLA AFEEHPASTGALYP

GNLCKLEYNAAVAL YPKGLSLESFSVIVLQLLSIGMGLTYDTENCHCTGEVCLMTPKAI IYSGGVKDFSTCTLDDFKYLSTRQDLRCLQDLPLERKPA

RRPRRICGNGILEMNEQCDCGTLK NCTHRKCCDPMSCRLKNKATCGSGECCSQDCT VKMNDVVCRKSVDECDFVEYCNGKDPYCVPNTYARNGQYCES

GEAFCFEGRCQTADKQCMSMLGKY YVRGASFACYEEFNSRGDRFGNCIHNFCAFR RNSLCGKLICTWPFKKLVLKANLSVAYAQIRDDLCVAMYKGGR

IPKTTKTTYSNPADRDETFVNDGTICGPDM FCLRASCTETRFHMDSSKCDSTRDCNDHG VCNNLQHCHCDIGYNPPFCEEHKGQFGSVDDGHKYHVED

 DGKSYKQQSHSNLKKNQLQLILYISLPLLVMISAVVIKQSKLSRVCDRERSESDS SSTTEDSGSNTNVTSSGGS STSH
Transcript ENSMUST00000050300
Sequence
AATTCTGGGGACAGTACGCCGAAGTATCCTGGAAGATGCGTGGCTGCCGTCAGTAACCTGAATATTTTCGGATATCTTTTCCTCAGTGATGTGTAAATTT

TTTTTAAAAGACATGATAAATGATACAAAGAAAATCCTTACCAGCTCTTCCTAGCCTGAAGAGTAAACCTGCAGGCATCCACCTTCCTTTTTACAGTTAG

CAGGATGGTTGGTACCTGAATCTATGCATCTATCTCGTTCTCCAGCCCTTTCTGCTCTGGTTTCCCTAGCGACAACCCTGCAGGTTCAGGGCCCAGAGCT

TCCGTTACTGGACACAACGCCCGCCCCGCCCAGCCTGTTGCTCCGCAGCAAAGCTCCAAGACCACCAAGGGAGCCATGTTCCTCCTTCTTTTGCTCTTTT

TGCATCTTAAAGGGCTGCAGGCAGGCCAGA ATCCTCAGAAAACCACCCTGCAGACAACTGTTCCTGAAAAGATCTCATCACCGGATGTGGAAACAGATG

CAGAAGACCAT ATGGCTTATCTTATTACAATAAATGAAACCCCCCATTTCATCCATCTTAAAAAACA ATCATTTATAACTCCAACTGCAGTTGTTTAT

ACTTACGACAGAAATGATGTTCAACATTCTCAACCTTTGTCAGCTCTG GAAAATTGCAATTACAATGGATATGTTGCAGGTTTCCCAAACTCTATCGTG

ACCCTCACCGTTTGCACAGGACTCAG GGGAATCATACAGTTTGAAAATGTCTCCTATGCAATCGAGCCCGTGGAAACCCTGTCAGGATTTGTGCACGTG

ATCTATGAGAACACAAACAAACATGCTGTGATTCCTGACCTGGGAAAGAATCAGTCATACAGTTGGTTTGACGAATCAGATTATCAATTCCGGAGTAACA

TGAAG AAATCTGGATTTACCGTGTTACGCCAACGATTCATTATGATGGATATCATCGTGGATAAAAAGCTG TTTGATTACATGGGTTCTGACACTGAA

GTTGTGCTACAGAAAGTCATTCAGATCATCGGTTTCGTTAACACT ATGCTCTCCAAGTTAAAACTGACTGTCTTAATAAATTCCATTGAAATCTGGTCG

AAGGAAAACAGAATTCGTTTATCAAAGGCAGTTGATGACTTATTGGTTCAGTTCTCAATTTGGAAACATGAGTATAGATCACAACATGTTGCATACTTAC

TGGC ATTTGAGGAGCACCCTGCTTCCACGGGGGCTCTATATCCAGGGAATCTGTGCAAACTGGAGTACAATGCTGCTGTTGCCCTG TATCCAAAAGGT

TTATCGTTAGAATCGTTTAGTGTCATTGTCCTGCAGCTGCTGAGCATTGGTATGGGCTTAACTTACGACACTGAGAACTGCCACTGTACAGGAGAAGTTT

GCCTAATGACGCCCAAAGCAAT ATATTCTGGGGGTGTGAAGGACTTCAGTACTTGTACCCTGGATGACTTTAAATACCTGTCAACAAGACAAGACCTTA

GATGTCTCCAGGACTTGCCTTTGGAAAGAAAGCCAGCTCGCAGGCCAAGGAGAATCTGTGGCAATGGGATACTGGAGATGAACGAGCAATGTGACTGTGG

CACTTTGAAG AACTGTACACATAGAAAATGCTGTGACCCTATGTCATGTCGATTGAAAAACAAGGCCACGTGTGGTTCTGGGGAGTGCTGTAGTCAAGA

TTGCACG GTAAAAATGAATGATGTGGTCTGTAGAAAGTCGGTAGATGAATGTGACTTTGTGGAGTACTGTAACGGAAAAGATCCCTATTGTGTCCCTAA

CACATATGCACGCAATGGGCAGTATTGTGAATCAGGTGAAGCCTTCTGTTTTGAAGGACGATGTCAGACTGCTGACAAGCAATGTATGAGCATGCTTGGG

AAAT ACGTGAGAGGGGCTTCCTTTGCGTGCTATGAAGAGTTCAATTCCAGAGGCGATAGATTTGGCAACTGTATTCATAATTTTTGTGCTTTCAG AAA

TTCTCTCTGTGGGAAACTAATCTGTACGTGGCCATTCAAGAAGCTGGTGCTAAAAGCCAATTTATCTGTGGCCTATGCGCAAATCCGGGATGACTTGTGT

GTAGCTATGTATAAAGGTGGGAGGATACCTAAGACAACAAAGACGACATATTCCAATCCAGCGGACAGAGATGAGACATTTGTAAACGACGGCACCATCT

GTGGCCCTGATATG TTTTGTTTGAGAGCATCATGCACAGAAACTAGATTTCACATGGATTCTTCCAAGTGTGATTCAACTAGAGATTGCAACGACCATG

GG GTTTGCAACAATTTACAGCATTGCCACTGTGATATAGGATATAACCCTCCTTTTTGTGAGGAACATAAGGGACAGTTTGGAAGCGTTGATGATGGAC

ATAAATATCATGTTGAAG ATGGTAAAAGCTATAAGCAGCAAAGTCATAGTAATCTTAAAAAAAATCAGCTTCAGCTCATTCTCTACATATCTCTGCCCT

TACTTGTGATGATTTCAGCTGTAGTTATAAAGCAAAGCAAACTGAGTCGTGTATGTGACAGAGAAAGAAGTGAAAGCGACAG CTCTACAACAGAAGATA

GCGGGAGTAACACCAATGTGACCAGCAGTGGAGGAAG - UNI28539 - CTCATCTACGGACCCACCAATCACACCAAACCCAGAAAGGATTCTGTAC

GTCTTTGCTCTGAAGAAACACTAA
Translation
MFLLLLLFLHLKGLQAGQN NPQKTTLQTTVPEKISSPDVETDAEDH MAYLITINETPHFIHLKKQ QSFITPTAVVYTYDRNDVQHSQPLSAL ENCN

YNGYVAGFPNSIVTLTVCTGLR RGIIQFENVSYAIEPVETLSGFVHVIYENTNKHAVIPDLGKNQSYSWFDESDYQFRSNMK KSGFTVLRQRFIMMDI

IVDKKL FDYMGSDTEVVLQKVIQIIGFVNT MLSKLKLTVLINSIEIWSKENRIRLSKAVDDLLVQFSIWKHEYRSQHVAYLLA AFEEHPASTGALYP

GNLCKLEYNAAVAL YPKGLSLESFSVIVLQLLSIGMGLTYDTENCHCTGEVCLMTPKAI IYSGGVKDFSTCTLDDFKYLSTRQDLRCLQDLPLERKPA

RRPRRICGNGILEMNEQCDCGTLK NCTHRKCCDPMSCRLKNKATCGSGECCSQDCT VKMNDVVCRKSVDECDFVEYCNGKDPYCVPNTYARNGQYCES

GEAFCFEGRCQTADKQCMSMLGKY YVRGASFACYEEFNSRGDRFGNCIHNFCAFR RNSLCGKLICTWPFKKLVLKANLSVAYAQIRDDLCVAMYKGGR

IPKTTKTTYSNPADRDETFVNDGTICGPDM FCLRASCTETRFHMDSSKCDSTRDCNDHG VCNNLQHCHCDIGYNPPFCEEHKGQFGSVDDGHKYHVED

 DGKSYKQQSHSNLKKNQLQLILYISLPLLVMISAVVIKQSKLSRVCDRERSESDS SSTTEDSGSNTNVTSSGGS - UNI28539 - SSSTDPPITP

NPERILYVFALKKH

For any suggestions or comments, please send an email to unitrap@crg.es