Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031562 (Dctd)
Chromosomal location
Chr 8: 49195539 - 49227017 (+)
Description
dCMP deaminase Gene [Source:MGI Symbol;Acc:MGI:2444529]
RefSeq_dna
NM_178788 
RefSeq_peptide
NP_848903.1 
UniGene
Mm.406717 
MGI
MGI:2444529 
Uniprot/SWISSPROT
Q8K2D6 
Uniprot/SPTREMBL
Q3UUA6 
Human Ortholog
ENSG00000129187 (DCTD)
Omim not available
UniTrap UNI25559
Vector Insertion
Chr 8: 49195603 - 49197012
Public Clones not available
Private Clones OST177033 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28095
Vector Insertion
Chr 8: 49197458 - 49222611
Public Clones not available
Private Clones OST40101 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37238
Vector Insertion
Chr 8: 49222729 - 49223532
Public Clones CMHD-GT_472D11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033966
Sequence
GCGCGCACGGCGGCTGTGTGGGGTGGACGGTGCAAGCGTGGTCTGCACCTCGAAGGAGCGGACG - UNI25559 - TGACGTATGACTTCTACACCCA

ACATGAGTGACATTTCCTGCAAAAAACGGGATGACTATCTGGAATGGCCCGAGTATTTCATGGCAGTGGCCTTCTTGTCAGCACAAAGAAGCAAGGACCC

AAGTTCCCAG GTGGGGGCCTGCATTGTGAACACAGAAAACAAGATTGTTGGGATCGGGTACAATGGCATGCCAAATGGGTGCAGTGATGACCTGTTGCC

TTGGAGGAGAACAGCAGAAAATAAGCTGGATACTAAATATCCTTATG - UNI28095 - TGTGCCATGCCGAGCTGAACGCCATCATGAACAAGAACT

CGGCTGATGTGAAGGGCTGCAGCATGTACGTCGCCTTGTTCCCGTGTAACGAATGTGCTAAACTCATCATCCAGGCAG - UNI37238 - GTATAAAA

GAGGTTATCTTCATGTCGGATAAATACCACGACAGCGAGGAGACGACAGCTGCCAGGCTCCTGTTTAAGTTGGCTGGGGTTACGTTCAG AAAATTCACA

CCGAAGTACAGCAAGATTGTCATTGACTTTGATTCGATCAATAGCCGACCGAGTCAGAAGCCTCAGTGAGTTTCGTCTCGTTAAAGCCCCAGAAGAAGAT

GACACCCCACCACGTGCGTGCACACACACACACACACACACACATACACACACACACAAGGGGCTCCCCAAGCCTTTCATCTTGAAGTCCCACGGAACTT

TTTAATAACACAACACTAAACATCTAAAGAATATAAAACTTGGAATCTTCTCACCCGTCACGTGGAGCTCCATCTGTTTCAGCTGTTGATGTAGTTTGGT

TTGGAAACTAAGGGACCTGCCCACAGGAGCTGGAGTGAAGGTCTCTCCCCTTCCGCCGAGCCCGTCTGCCAGAGAGTGTCAGCTCTGTCATCCACCATAT

TTCGACAGCCGCTCCTTGCTGCTACACGGGGTAGGAGGACATACAAATAATTGCTTCTCGTTCTTAGCAGGGATGAACAGGCACACTGAGGTGAACATCT

GGCCCAAATGAAGCATACCCTGTCACGCCCTTGGGAAAACAAATAGGACCGAACAAAGCTACATGAACACACCTGCTGTAGAGTTGAGGGGACCTCTCAC

CTGGTCACATGAGGTTGAGGAGGGCCCAGTGTCCTGGCAGATGATCAGTACAGTGTCCCCCTCAAGTCACACTTTCCTGCCTTACACAGAGCAGTAGCAT

ACCATCCCTCTGGAGGGTAGGGGACCCCTGCGGTTCCAGCCTCTTAGCCTTGGTTTGTTGGTCACATAGCACTGTTAAATTTATCCGAGGCATAAGTAGT

TCCTAGAGGAGACAGTCTATCACTCCCCCTAGACCAGGCGCTTTGCGGTGACAGCTGGAGCTATATGGATGGGTGATGAGAGACGTTCCCCCATCCTGTG

TCTCCTGCTGTGTGGACACATGTCACTCCTGCTCCACATGCCAACATGGTTCATTTCCAAGGGCACCCTATAACCAGAGAGCACATTAATTCCTGTCCTA

TAAGAGGGCTGTGGGAAACTGTGTACCTGGAGGTGGTCCATGCCAGATCCTCATTTGTGCCTTCAGCTTCATAGGCAGCATACGCCTGCTGCCCCATTGT

GGGTGGGGGTGCCCCACTGCGTACTGTGTTTTTAATTTCATTTAACTTCTAGCAGACACGCTCAGTGTCTTTGATAAAATAGTGTCTTTTTTTCATGTGT

TTTTATTTCATTTCTAAGATTTTTTTTTTAACACTCCGTATTCTGGAGCATTTTTTTACAATTTGGATCTCTGCCAGTATTGTTAAAATTTTATTAAAAT

CATCCAGCACC
Translation
 - UNI25559 - MSDISCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQ VGACIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYV - 

UNI28095 - VCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAG - UNI37238 - GIKEVIFMSDKYHDSEETTAARLLFKLAGVTFR R

KFTPKYSKIVIDFDSINSRPSQKPQ
Transcript ENSMUST00000098773
Sequence
GCGCGCACGGCGGCTGTGTGGGGTGGACGGTGCAAGCGTGGTCTGCACCTCGAAGGAGCGGACG - UNI25559 - TGACGTATGACTTCTACACCCA

ACATGAGTGACATTTCCTGCAAAAAACGGGATGACTATCTGGAATGGCCCGAGTATTTCATGGCAGTGGCCTTCTTGTCAGCACAAAGAAGCAAGGACCC

AAGTTCCCAG GTGGGGGCCTGCATTGTGAACACAGAAAACAAGATTGTTGGGATCGGGTACAATGGCATGCCAAATGGGTGCAGTGATGACCTGTTGCC

TTGGAGGAGAACAGCAGAAAATAAGCTGGATACTAAATATCCTTATG - UNI28095 - TGTGCCATGCCGAGCTGAACGCCATCATGAACAAGAACT

CGGCTGATGTGAAGGGCTGCAGCATGTACGTCGCCTTGTTCCCGTGTAACGAATGTGCTAAACTCATCATCCAGGCAG - UNI37238 - ATGAAGAG

GTCGGCAGTGGGAGCGTGCAGCGAGCAGTGTGTGGGCTCTGTGGTCAGCCGGCTCATCCCCTCTGA
Translation
 - UNI25559 - MTSTPNMSDISCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQ VGACIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKY

PYV - UNI28095 - VCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAD - UNI37238 - DEEVGSGSVQRAVCGLCGQPAHPL

For any suggestions or comments, please send an email to unitrap@crg.es