Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031565 (Fgfr1)
Chromosomal location
Chr 8: 26629244 - 26686186 (+)
fibroblast growth factor receptor 1 Gene [Source:MGI (curated);Acc:Fgfr1-001]
NP_001073377.1 NP_034336.2 NP_001073378.1 
Q3TJ05 Q8CBY7 Q9JJ17 Q9QZM7 Q9R1A2 Q8CFK8 Q61565 Q8CIM9 Q60818 Q60830 
Human Ortholog
ENSG00000077782 (FGFR1)
UniTrap UNI37959
Vector Insertion
Chr 8: 26629266 - 26629902
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30729
Vector Insertion
Chr 8: 26629902 - 26642721
Public Clones (sanger) IST14603D5 (tigm) IST14873H12 (tigm) IST14870E4 (tigm) IST14391A5 (tigm)
IST14461F8 (tigm) IST11583E8 (tigm) IST13045D4 (tigm) IST14668A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11247
Vector Insertion
Chr 8: 26642752 - 26642901
Public Clones (ggtc) G019C04 (ggtc) P014D05 (ggtc) G026F12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14298
Vector Insertion
Chr 8: 26642901 - 26665943
Public Clones FHCRC-GT-S3-6C1 (fhcrc) FHCRC-GT-S20-5A1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16727
Vector Insertion
Chr 8: 26642901 - 26665979
Public Clones (sanger) E112H05 (ggtc) D150H09 (ggtc) 5SE285G11 (ggtc) E052H09 (ggtc)
E323C04 (ggtc) D156C03 (ggtc) E089F12 (ggtc) D097E11 (ggtc) 3SE285G11 (ggtc)
E052E04 (ggtc) 5SE187F03 (ggtc) 5SE285B11 (ggtc) E325C08 (ggtc)
E050B03 (ggtc) CMHD-GT_524A1-5S (cmhd) CMHD-GT_421G4-3 (cmhd) IST11636D3 (tigm)
IST11564D5 (tigm) IST12562G7 (tigm) IST11503D9 (tigm) IST11574E2 (tigm)
IST12178A2 (tigm) IST12174D1 (tigm) IST12650H5BBF1 (tigm) IST12174B5 (tigm)
IST14444C6 (tigm) IST13002B1 (tigm) IST11824B7 (tigm) IST11974G9 (tigm)
IST14675D8 (tigm) IST13544C11 (tigm) IST14167A6 (tigm) IST14864A9 (tigm)
IST13803B10 (tigm) IST12171C8 (tigm) IST12838D2 (tigm) IST14274F5 (tigm)
IST12947F9 (tigm) IST11469G8 (tigm) IST10752E7 (tigm) IST11850H8 (tigm)
IST14418A12 (tigm) IST12177B1 (tigm) IST10543B12 (tigm) IST12905G10HMF1 (tigm)
IST10080B2 (tigm) IST10880E9 (tigm) IST12442E12 (tigm) IST12060F11 (tigm)
IST13056F12 (tigm) IST12552G10 (tigm) IST14929D3 (tigm) IST14703G9 (tigm)
IST12880G6 (tigm) IST13044E7 (tigm) IST12437B12 (tigm) IST13061D12 (tigm)
IST12558G7 (tigm) IST12640D8 (tigm) IST13063E9 (tigm) IST10102E7 (tigm)
IST13016G11 (tigm) IST12174E8 (tigm) IST11706B2 (tigm) IST11503D8 (tigm)
IST12107G7 (tigm) IST10831G12 (tigm) IST11364B12 (tigm) IST13663G1 (tigm)
IST13082B5 (tigm) IST12121C7 (tigm)
Private Clones OST455440 (lexicon) OST454997 (lexicon) OST444568 (lexicon) OST175078 (lexicon)
OST102212 (lexicon) OST42153 (lexicon) OST33270 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13149
Vector Insertion
Chr 8: 26665979 - 26666247
Public Clones CMHD-GT_268H9-3 (cmhd) CMHD-GT_324G5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26903
Vector Insertion
Chr 8: 26668293 - 26668542
Public Clones not available
Private Clones OST87170 (lexicon) OST80086 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24632
Vector Insertion
Chr 8: 26668716 - 26671191
Public Clones not available
Private Clones OST212180 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11166
Vector Insertion
Chr 8: 26672801 - 26673845
Public Clones G064D05 (ggtc) G036F06 (ggtc) G062B07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33862
Vector Insertion
Chr 8: 26674957 - 26677182
Public Clones IST12776D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36978
Vector Insertion
Chr 8: 26678806 - 26680110
Public Clones CMHD-GT_534G3-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18351
Vector Insertion
Chr 8: 26683262 - 26683594
Public Clones not available
Private Clones OST425113 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25604
Vector Insertion
Chr 8: 26684216 - 26685050
Public Clones not available
Private Clones OST174078 (lexicon) OST31014 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120106







































Transcript ENSMUST00000120612

























 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQD - UNI11247 - - UNI13149 - - UNI14298 - - 









Transcript ENSMUST00000119398





































 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQD - UNI11247 - - UNI13149 - - UNI14298 - - 









Transcript ENSMUST00000117179










































 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQA - UNI11247 - - UNI13149 - - UNI14298 - - 










Transcript ENSMUST00000118241










































 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQA - UNI11247 - - UNI13149 - - UNI14298 - - 










Transcript ENSMUST00000110623

















































 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQD - UNI11247 - - UNI13149 - - UNI14298 - - 









Transcript ENSMUST00000084027




















































 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQG - UNI11247 - - UNI14298 - - UNI16727 - GS











For any suggestions or comments, please send an email to