Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031565 (Fgfr1)
Chromosomal location
Chr 8: 26629244 - 26686186 (+)
Description
fibroblast growth factor receptor 1 Gene [Source:MGI (curated);Acc:Fgfr1-001]
RefSeq_dna
NM_001079909 
RefSeq_peptide
NP_001073377.1 NP_034336.2 NP_001073378.1 
MGI
MGI:95522 
Uniprot/SWISSPROT
P16092 
Uniprot/SPTREMBL
Q3TJ05 Q8CBY7 Q9JJ17 Q9QZM7 Q9R1A2 Q8CFK8 Q61565 Q8CIM9 Q60818 Q60830 
Human Ortholog
ENSG00000077782 (FGFR1)
Omim 101600 - PFEIFFER SYNDROME  146110 - HYPOGONADOTROPIC HYPOGONADISM  147950 - KALLMANN SYNDROME 2  166250 - OSTEOGLOPHONIC DYSPLASIA  190440 - TRIGONOCEPHALY, NONSYNDROMIC  
UniTrap UNI37959
Vector Insertion
Chr 8: 26629266 - 26629902
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30729
Vector Insertion
Chr 8: 26629902 - 26642721
Public Clones (sanger) IST14870E4 (tigm) IST14391A5 (tigm) IST14461F8 (tigm) IST11583E8 (tigm)
IST13045D4 (tigm) IST14668A11 (tigm) IST14603D5 (tigm) IST14873H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11247
Vector Insertion
Chr 8: 26642752 - 26642901
Public Clones G019C04 (ggtc) P014D05 (ggtc) G026F12 (ggtc) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14298
Vector Insertion
Chr 8: 26642901 - 26665943
Public Clones FHCRC-GT-S3-6C1 (fhcrc) FHCRC-GT-S20-5A1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16727
Vector Insertion
Chr 8: 26642901 - 26665979
Public Clones (sanger) E323C04 (ggtc) D156C03 (ggtc) E089F12 (ggtc) D097E11 (ggtc)
E052E04 (ggtc) 3SE285G11 (ggtc) E112H05 (ggtc) 5SE187F03 (ggtc) E325C08 (ggtc)
E050B03 (ggtc) 5SE285B11 (ggtc) D150H09 (ggtc) E052H09 (ggtc) 5SE285G11 (ggtc)
CMHD-GT_524A1-5S (cmhd) CMHD-GT_421G4-3 (cmhd) IST14167A6 (tigm) IST14864A9 (tigm)
IST13803B10 (tigm) IST12171C8 (tigm) IST12838D2 (tigm) IST14274F5 (tigm)
IST13544C11 (tigm) IST11469G8 (tigm) IST10752E7 (tigm) IST11850H8 (tigm)
IST14418A12 (tigm) IST12177B1 (tigm) IST10543B12 (tigm) IST12947F9 (tigm)
IST12905G10HMF1 (tigm) IST10080B2 (tigm) IST10880E9 (tigm) IST12442E12 (tigm)
IST12060F11 (tigm) IST13056F12 (tigm) IST12552G10 (tigm) IST14703G9 (tigm)
IST12880G6 (tigm) IST13044E7 (tigm) IST12437B12 (tigm) IST13061D12 (tigm)
IST12558G7 (tigm) IST14929D3 (tigm) IST12640D8 (tigm) IST13063E9 (tigm)
IST10102E7 (tigm) IST13016G11 (tigm) IST12174E8 (tigm) IST11706B2 (tigm)
IST11503D8 (tigm) IST12107G7 (tigm) IST10831G12 (tigm) IST11364B12 (tigm)
IST13663G1 (tigm) IST13082B5 (tigm) IST12121C7 (tigm) IST11564D5 (tigm)
IST12562G7 (tigm) IST11503D9 (tigm) IST11574E2 (tigm) IST12178A2 (tigm)
IST12174D1 (tigm) IST11636D3 (tigm) IST12650H5BBF1 (tigm) IST12174B5 (tigm)
IST14444C6 (tigm) IST13002B1 (tigm) IST11824B7 (tigm) IST11974G9 (tigm)
IST14675D8 (tigm)
Private Clones OST455440 (lexicon) OST454997 (lexicon) OST444568 (lexicon) OST175078 (lexicon)
OST102212 (lexicon) OST42153 (lexicon) OST33270 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13149
Vector Insertion
Chr 8: 26665979 - 26666247
Public Clones CMHD-GT_268H9-3 (cmhd) CMHD-GT_324G5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26903
Vector Insertion
Chr 8: 26668293 - 26668542
Public Clones not available
Private Clones OST87170 (lexicon) OST80086 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24632
Vector Insertion
Chr 8: 26668716 - 26671191
Public Clones not available
Private Clones OST212180 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11166
Vector Insertion
Chr 8: 26672801 - 26673845
Public Clones G064D05 (ggtc) G036F06 (ggtc) G062B07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33862
Vector Insertion
Chr 8: 26674957 - 26677182
Public Clones IST12776D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36978
Vector Insertion
Chr 8: 26678806 - 26680110
Public Clones CMHD-GT_534G3-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18351
Vector Insertion
Chr 8: 26683262 - 26683594
Public Clones not available
Private Clones OST425113 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25604
Vector Insertion
Chr 8: 26684216 - 26685050
Public Clones not available
Private Clones OST174078 (lexicon) OST31014 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120106
Sequence
GTGGAATATCCATGGAGGTACGGAGCCTTGTTACCAACCTCTAACCGCAGAACTGGGATGTGGGGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCA

CAGCCACTCTCTGCACTGCCAGGCCAGCCCCAACCTTGCCTGAACAAG - UNI11247 - - UNI13149 - - UNI14298 - - UNI16727 -

 ATGCACTCCCATCCTCGGAAGATGATGACGACGACGATGACTCCTCCTCGGAGGAGAAAGAGACGGACAACACCAAACCAAACC - UNI26903 - C

TGTAGCTCCCTACTGGACATCCCCAGAGAAAATGGAGAAGAAACTGCATGCGGTGCCCGCTGCCAAGACGGTGAAGTTCAAGTGCCCGTCGAGTGGGACA

CCCAACCCCACTCTGCGCTGGTTGAAAAATGGCAAAGAGTTTAAGCCTGACCACCGAATTGGAGGCTACAAG - UNI24632 - GTTCGCTATGCCAC

CTGGAGCATCATAATGGATTCTGTGGTGCCTTCTGACAAGGGCAACTACACCTGCATCGTGGAGAATGAGTATGGGAGCATCAACCACACCTACCAGCTT

GACGTCGTGG AACGATCTCCGCACCGACCCATCCTTCAGGCAGGGCTGCCTGCCAACAAGACAGTGGCCCTGGGCAGCAATGTGGAGTTCATGTGTAAG

GTGTACAGCGATCCGCAGCCTCACATTCAGTGGCTGAAGCACATCGAGGTGAACGGGAGTAAGATCGGGCCAGACAACTTGCCGTATGTCCAGATCCTGA

AG - UNI11166 - CATTCGGGAATTAATAGCTCGGATGCGGAGGTGCTGACCCTGTTCAATGTGACAGAGGCCCAGAGCGGGGAGTATGTGTGTAAG

GTTTCCAATTATATTGGTGAAGCTAACCAGTCTGCGTGGCTCACTGTCACCAGACCTGTGGCAAAAG - UNI33862 - CCCTGGAAGAGAGACCAGC

TGTGATGACCTCACCGCTCTACCTGGAGATCATTATCTACTGCACCGGGGCCTTCCTGATCTCCTGCATGTTGGGCTCTGTCATCATCTATAAGATGAAG

AGCGGCACCAAGAAGAGCGACTTCCATAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAG TACACT GTGTCAGCTGACTC

CAGTGCATCCATGAACTCTGGGGTTCTCCTGGTTCGGCCCTCACGGCTCTCCTCCAGCGGGACCCCCATGCTGGCTGGAGTCTCCGAATATGAGCTCCCT

GAGGATCCCCGCTGGGAGCTGCCACGAGACAG - UNI36978 - ACTGGTCTTAGGCAAACCACTTGGCGAGGGCTGCTTCGGGCAGGTGGTGTTGGC

TGAGGCCATCGGGCTGGATAAGGACAAACCCAACCGTGTGACCAAAGTGGCCGTGAAGATGTTGAAGT CCGACGCAACGGAGAAGGACCTGTCGGATCT

GATCTCGGAGATGGAGATGATGAAAATGATTGGGAAGCACAAGAATATCATCAACCTTCTGGGAGCGTGCACACAGGATG GTCCTCTTTATGTCATTGT

GGAGTACGCCTCCAAAGGCAATCTCCGGGAGTATCTACAGGCCCGGAGGCCTCCTGGGCTGGAGTACTGCTATAACCCCAGCCACAACCCCGAGGAACAG

CTGTCTTCCAAAGATCTGGTATCCTGTGCCTATCAGGTGGCTCGGGGCATGGAGTATCTTGCCTCTAAGAAG TGTATACACCGAGACCTGGCTGCTAGG

AACGTCCTGGTGACCGAGGATAACGTAATGAAGATCGCAGACTTTGGCTTAGCTCGAGACATTCATCATATCGACTACTACAAGAAAACCACCAAC GGC

CGGCTGCCTGTGAAGTGGATGGCCCCTGAGGCGTTGTTTGACCGGATCTACACACACCAGAGCGATGT - UNI18351 - GTGGTCTTTTGGAGTGCT

CTTGTGGGAGATCTTCACTCTGGGTGGCTCCCCATACCCCGGTGTGCCTGTGGAGGAACTTTTCAAGCTGCTGAAGGAGGGTCATCGAATGGACAAGCCC

AGTAACTGTACCAATGAGCT GTACATGATGATGCGGGACTGCTGGCATGCAGTGCCCTCTCAGAGACCTACGTTCAAGCAGTTGGTGGAAGACCTGGAC

CGCATTGTGGCCTTGACCTCCAACCAG - UNI25604 - GAGTATCTGGACCTGTCCATACCGCTGGACCAGTACTCACCCAGCTTTCCCGACACACG

GAGCTCCACCTGCTCCTCAGGGGAGGACTCTGTCTTCTCTCATGAGCCGTTACCTGAGGAGCCCTGTCTGCCTCGACACCCCACCCAGCTTGCCAACAGT

GGACTCAAACGGCGCTGACTACCAACCCTGTCCCCAGTTTTCTCCCATTCCGTCGTCACCCGTGCCCCTCACCCACAATCCCCTTGTTGGACACACTGCC

TTTCTCCTCCTCCTTTGCCGCTGGCAAGAGCCAGTGCCTGACTGAGGCCTTCCTGTGTTGTGGCCTTCCCCCTCCATCACCCCCAAGACCCCTCTTCTCC

CTCTTCTTAGCCTGCTGTGTGAGAGAGGAGCCAAGAGGCAGGTGCTTGCCGACGGCCGCATCCTCCTTCCCAGGTGTTGGACCAAGACCCGCCCCGCTGC

CTGGCACTGCTTGGAGGTGTGCAGAGCGGAAGCAAGTGGAGCATCCGGGGCATTCCTGTTGACCCATCAGCCCCTTCTGTTCTGGCGGCAGGGGCCTTGG

GGCTCCTGGAAGCCGTGAGGTTTCTGTTTAGGCCTTAACCGAAGGCAACCTCTGCTCCAGATGGATGGTACCAGTAGCTTCTTAATTCCAATACTAATTT

GCTTTGCTGACCAAATACCTGCCTGGTACCAGAAGACAGGGAGGCAGAGACTGGGAGCCGTGATGTGCCCTTGGGCTGAGCCCTAGACTTGGGGCTCTGT

ACATAGCTATGAAGAAAAACACAAAGTGTATAAATCTTGAGTATATATTTACATGTCTTTTTAAAAAGGGTCGT
Translation
MWGWKCLLFWAVLVTATLCTARPAPTLPEQD - UNI11247 - - UNI13149 - - UNI14298 - - UNI16727 - DALPSSEDDDDDDDSS

SEEKETDNTKPNP - UNI26903 - PVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYK - UNI24632 - V

RYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVE ERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLP

YVQILK - UNI11166 - HSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSAWLTVTRPVAKA - UNI33862 - ALEERPAVMTSPLYL

EIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQ YT VSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWEL

PRDR - UNI36978 - RLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKS SDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDG 

GPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKK CIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDY

YKKTTN GRLPVKWMAPEALFDRIYTHQSDV - UNI18351 - VWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNEL LYMMMRD

CWHAVPSQRPTFKQLVEDLDRIVALTSNQ - UNI25604 - EYLDLSIPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKR

R
Transcript ENSMUST00000120612
Sequence
ACCCCATCAGGATCTGAACGGAGCCCGGAGACGAGCGGCGGGAGCGCAAGACACAGACACCCGCCGCGCCACGGCGAGCTCTCCAGAGGCGGGACCGCAG

CGCCAAGTGAG - UNI30729 - - UNI37959 - AGTCAGCTTGCGAAGGCAGACCACGCTCACGGTGGAATATCCATGGAGGTACGGAGCCTTGT

TACCAACCTCTAACCGCAGAACTGGGATGTGGGGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACTCTCTGCACTGCCAGGCCAGCCCC

AACCTTGCCTGAACAAG - UNI11247 - - UNI13149 - - UNI14298 - - UNI16727 - ATGCACTCCCATCCTCGGAAGATGATGACG

ACGACGATGACTCCTCCTCGGAGGAGAAAGAGACGGACAACACCAAACCAAACCGTAGGC - UNI26903 - CTGTAGCTCCCTACTGGACATCCCCA

GAGAAAATGGAGAAGAAACTGCATGCGGTGCCCGCTGCCAAGACGGTGAAGTTCAAGTGCCCGTCGAGTGGGACACCCAACCCCACTCTGCGCTGGTTGA

AAAATGGCAAAGAGTTTAAGCCTGACCACCGAATTGGAGGCTACAAG - UNI24632 - GTTCGCTATGCCACCTGGAGCATCATAATGGATTCTGTG

GTGCCTTCTGACAAGGGCAACTACACCTGCATCGTGGAGAATGAGTATGGGAGCATCAACCACACCTACCAGCTTGACGTCGTGG AACGATCTCCGCAC

CGACCCATCCTTCAGGCAGGGCTGCCTGCCAACAAGACAGTGGCCCTGGGCAGCAATGTGGAGTTCATGTGTAAGGTGTACAGCGATCCGCAGCCTCACA

TTCAGTGGCTGAAGCACATCGAGGTGAACGGGAGTAAGATCGGGCCAGACAACTTGCCGTATGTCCAGATCCTGAAG - UNI11166 - ACTGCTGGA

GTTAATACCACCGACAAGGAAATGGAGGTGCTTCATCTACGGAATGTCTCCTTTGAGGATGCGGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGAC

TCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAG - UNI33862 - CCCTGGAAGAGAGACCAGCTGTGATGACCTCACCGCTCTACCTGGAGATC

ATTATCTACTGCACCGGGGCCTTCCTGATCTCCTGCATGTTGGGCTCTGTCATCATCTATAAGATGAAGAGCGGCACCAAGAAGAGCGACTTCCATAGCC

AGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAG TACACT GTGTCAGCTGACTCCAGTGCATCCATGAACTCTGGGGTTCTCCTG

GTTCGGCCCTCACGGCTCTCCTCCAGCGGGACCCCCATGCTGGCTGGAGTCTCCGAATATGAGCTCCCTGAGGATCCCCGCTGGGAGCTGCCACGAGACA

G - UNI36978 - ACTGGTCTTAGGCAAACCACTTGGCGAGGGCTGCTTCGGGCAGGTGGTGTTGGCTGAGGCCATCGGGCTGGATAAGGACAAACCC

AACCGTGTGACCAAAGTGGCCGTGAAGATGTTGAAGT CCGACGCAACGGAGAAGGACCTGTCGGATCTGATCTCGGAGATGGAGATGATGAAAATGATT

GGGAAGCACAAGAATATCATCAACCTTCTGGGAGCGTGCACACAGGATG GTCCTCTTTATGTCATTGTGGAGTACGCCTCCAAAGGCAATCTCCGGGAG

TATCTACAGGCCCGGAGGCCTCCTGGGCTGGAGTACTGCTATAACCCCAGCCACAACCCCGAGGAACAGCTGTCTTCCAAAGATCTGGTATCCTGTGCCT

ATCAGGTGGCTCGGGGCATGGAGTATCTTGCCTCTAAGAAG TGTATACACCGAGACCTGGCTGCTAGGAACGTCCTGGTGACCGAGGATAACGTAATGA

AGATCGCAGACTTTGGCTTAGCTCGAGACATTCATCATATCGACTACTACAAGAAAACCACCAAC GGCCGGCTGCCTGTGAAGTGGATGGCCCCTGAGG

CGTTGTTTGACCGGATCTACACACACCAGAGCGATGT - UNI18351 - GTGGTCTTTTGGAGTGCTCTTGTGGGAGATCTTCACTCTGGGTGGCTCC

CCATACCCCGGTGTGCCTGTGGAGGAACTTTTCAAGCTGCTGAAGGAGGGTCATCGAATGGACAAGCCCAGTAACTGTACCAATGAGCT GTACATGATG

ATGCGGGACTGCTGGCATGCAGTGCCCTCTCAGAGACCTACGTTCAAGCAGTTGGTGGAAGACCTGGACCGCATTGTGGCCTTGACCTCCAACCAG - U

NI25604 - GAGTATCTGGACCTGTCCATACCGCTGGACCAGTACTCACCCAGCTTTCCCGACACACGGAGCTCCACCTGCTCCTCAGGGGAGGACTCT

GTCTTCTCTCATGAGCCGTTACCTGAGGAGCCCTGTCTGCCTCGACACCCCACCCAGCTTGCCAACAGTGGACTCAAACGGCGCTGA
Translation
 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQD - UNI11247 - - UNI13149 - - UNI14298 - - 

UNI16727 - DALPSSEDDDDDDDSSSEEKETDNTKPNRRP - UNI26903 - PVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKN

GKEFKPDHRIGGYK - UNI24632 - VRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVE ERSPHRPILQAGLPANKTVALGSNVEFMC

KVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILK - UNI11166 - TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEA -

 UNI33862 - ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQ YT VSADSSASMNSGVLLVRP

SRLSSSGTPMLAGVSEYELPEDPRWELPRDR - UNI36978 - RLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKS SDATEKDLSDLI

SEMEMMKMIGKHKNIINLLGACTQDG GPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKK CIHRDLAA

RNVLVTEDNVMKIADFGLARDIHHIDYYKKTTN GRLPVKWMAPEALFDRIYTHQSDV - UNI18351 - VWSFGVLLWEIFTLGGSPYPGVPVEELF

KLLKEGHRMDKPSNCTNEL LYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQ - UNI25604 - EYLDLSIPLDQYSPSFPDTRSSTCSSGEDS

VFSHEPLPEEPCLPRHPTQLANSGLKRR
Transcript ENSMUST00000119398
Sequence
CAGCGCTCGGAGCGCTCCTGCGGGTACTTTGGCGGGGCTCTCCGCTGCGGGCGGCGCGGAACGGGAGCCGGAACCCTGGTGCAGCCGCTGCGTGCAGAGG

ACCCGGGCTGCGCAGGGAAGCGGGGCCGAGACGTCCGGACTGGACTGAGACTGTGCTTAGCGCATTGCGGCGACCTCGCCTTTCCCGGCCGCGAGCGCGC

GCCGCAGCTGGAAAAGCAGCGGAGACCGAGGACTTTTCTCAGGTCCCAGGGGCGCACCACAGCCGTGCTGCAGTCAATGCACGCCGGAGCCCCAGGAGGG

GTGATGGAACTCGGGCTGCCAGAAGCCTGAGACGCCGCCACCGCCGCCGCTGCGTACTGGAGAGCGGGGGGCGCACGATCTGGGGACCCCGGGCGGCGGA

CCCGAGCCCTCCCCCCCGCCCCGCCTCCGGGGCACCAGCTTCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCCGGCTCGGAGTGCCGCCGGGAGTCG

TGCCTCGGCCGCGGAGCCCTCGAGACCCCATCAGGATCTGAACGGAGCCCGGAGACGAGCGGCGGGAGCGCAAGACACAGACACCCGCCGCGCCACGGCG

AGCTCTCCAGAGGCGGGACCGCAGCGCCAAGTGAG - UNI30729 - - UNI37959 - AGTCAGCTTGCGAAGGCAGACCACGCTCACGGTGGAAT

ATCCATGGAGGTACGGAGCCTTGTTACCAACCTCTAACCGCAGAACTGGGATGTGGGGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCAC

TCTCTGCACTGCCAGGCCAGCCCCAACCTTGCCTGAACAAG - UNI11247 - - UNI13149 - - UNI14298 - - UNI16727 - ATGCAC

TCCCATCCTCGGAAGATGATGACGACGACGATGACTCCTCCTCGGAGGAGAAAGAGACGGACAACACCAAACCAAACC - UNI26903 - CTGTAGCT

CCCTACTGGACATCCCCAGAGAAAATGGAGAAGAAACTGCATGCGGTGCCCGCTGCCAAGACGGTGAAGTTCAAGTGCCCGTCGAGTGGGACACCCAACC

CCACTCTGCGCTGGTTGAAAAATGGCAAAGAGTTTAAGCCTGACCACCGAATTGGAGGCTACAAG - UNI24632 - GTTCGCTATGCCACCTGGAGC

ATCATAATGGATTCTGTGGTGCCTTCTGACAAGGGCAACTACACCTGCATCGTGGAGAATGAGTATGGGAGCATCAACCACACCTACCAGCTTGACGTCG

TGG AACGATCTCCGCACCGACCCATCCTTCAGGCAGGGCTGCCTGCCAACAAGACAGTGGCCCTGGGCAGCAATGTGGAGTTCATGTGTAAGGTGTACA

GCGATCCGCAGCCTCACATTCAGTGGCTGAAGCACATCGAGGTGAACGGGAGTAAGATCGGGCCAGACAACTTGCCGTATGTCCAGATCCTGAAG - UN

I11166 - ACTGCTGGAGTTAATACCACCGACAAGGAAATGGAGGTGCTTCATCTACGGAATGTCTCCTTTGAGGATGCGGGGGAGTATACGTGCTTGG

CGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAG - UNI33862 - CCCTGGAAGAGAGACCAGCTGTGATGACCTCA

CCGCTCTACCTGGAGATCATTATCTACTGCACCGGGGCCTTCCTGATCTCCTGCATGTTGGGCTCTGTCATCATCTATAAGATGAAGAGCGGCACCAAGA

AGAGCGACTTCCATAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAG TACACT GTGTCAGCTGACTCCAGTGCATCCATG

AACTCTGGGGTTCTCCTGGTTCGGCCCTCACGGCTCTCCTCCAGCGGGACCCCCATGCTGGCTGGAGTCTCCGAATATGAGCTCCCTGAGGATCCCCGCT

GGGAGCTGCCACGAGACAG - UNI36978 - ACTGGTCTTAGGCAAACCACTTGGCGAGGGCTGCTTCGGGCAGGTGGTGTTGGCTGAGGCCATCGGG

CTGGATAAGGACAAACCCAACCGTGTGACCAAAGTGGCCGTGAAGATGTTGAAGT CCGACGCAACGGAGAAGGACCTGTCGGATCTGATCTCGGAGATG

GAGATGATGAAAATGATTGGGAAGCACAAGAATATCATCAACCTTCTGGGAGCGTGCACACAGGATG GTCCTCTTTATGTCATTGTGGAGTACGCCTCC

AAAGGCAATCTCCGGGAGTATCTACAGGCCCGGAGGCCTCCTGGGCTGGAGTACTGCTATAACCCCAGCCACAACCCCGAGGAACAGCTGTCTTCCAAAG

ATCTGGTATCCTGTGCCTATCAGGTGGCTCGGGGCATGGAGTATCTTGCCTCTAAGAAG TGTATACACCGAGACCTGGCTGCTAGGAACGTCCTGGTGA

CCGAGGATAACGTAATGAAGATCGCAGACTTTGGCTTAGCTCGAGACATTCATCATATCGACTACTACAAGAAAACCACCAAC GGCCGGCTGCCTGTGA

AGTGGATGGCCCCTGAGGCGTTGTTTGACCGGATCTACACACACCAGAGCGATGT - UNI18351 - GTGGTCTTTTGGAGTGCTCTTGTGGGAGATC

TTCACTCTGGGTGGCTCCCCATACCCCGGTGTGCCTGTGGAGGAACTTTTCAAGCTGCTGAAGGAGGGTCATCGAATGGACAAGCCCAGTAACTGTACCA

ATGAGCT GTACATGATGATGCGGGACTGCTGGCATGCAGTGCCCTCTCAGAGACCTACGTTCAAGCAGTTGGTGGAAGACCTGGACCGCATTGTGGCCT

TGACCTCCAACCAG - UNI25604 - GAGTATCTGGACCTGTCCATACCGCTGGACCAGTACTCACCCAGCTTTCCCGACACACGGAGCTCCACCTGC

TCCTCAGGGGAGGACTCTGTCTTCTCTCATGAGCCGTTACCTGAGGAGCCCTGTCTGCCTCGACACCCCACCCAGCTTGCCAACAGTGGACTCAAACGGC

GCTGACTACCAACCCTGTCCCCAGTTTTCTCCCATTCCGTCGTCACCCGTGCCCCTCACCCACAATCCCCTTGTTGGACACACTGCCTTTCTCCTCCTCC

TTTGCCGCTGGCAAGAGCCAGTGCCTGACTGAGGCCTTCCTGTGTTGTGGCCTTCCCCCTCCATCACCCCCAAGACCCCTCTTCTCCCTCTTCTTAGCCT

GCTGTGTGAGAGAGGAGCCAAGAGGCAGGTGCTTGCCGACGGCCGCATCCTCCTTCCCAGGTGTTGGACCAAGACCCGCCCCGCTGCCTGGCACTGCTTG

GAGGTGTGCAGAGCGGAAGCAAGTGGAGCATCCGGGGCATTCCTGTTGACCCATCAGCCCCTTCTGTTCTGGCGGCAGGGGCCTTGGGGCTCCTGGAAGC

CGTGAGGTTTCTGTTTAGGCCTTAACCGAAGGCAACCTCTGCTCCAGATGGATGGTACCAGTAGCTTCTTAATTCCAATACTAATTTGCTTTGCTGACCA

AATACCTGCCTGGTACCAGAAGACAGGGAGGCAGAGACTGGGAGCCGTGATGTGCCCTTGGGCTGAGCCCTAGACTTGGGGCTCTGTACATAGCTATGAA

GAAAAACACAAAGTGTATAAATCTTGAGTATATATTTACATGTCTTTTTAAAAAGGGTCGT
Translation
 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQD - UNI11247 - - UNI13149 - - UNI14298 - - 

UNI16727 - DALPSSEDDDDDDDSSSEEKETDNTKPNP - UNI26903 - PVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGK

EFKPDHRIGGYK - UNI24632 - VRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVE ERSPHRPILQAGLPANKTVALGSNVEFMCKV

YSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILK - UNI11166 - TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEA - U

NI33862 - ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQ YT VSADSSASMNSGVLLVRPSR

LSSSGTPMLAGVSEYELPEDPRWELPRDR - UNI36978 - RLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKS SDATEKDLSDLISE

MEMMKMIGKHKNIINLLGACTQDG GPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKK CIHRDLAARN

VLVTEDNVMKIADFGLARDIHHIDYYKKTTN GRLPVKWMAPEALFDRIYTHQSDV - UNI18351 - VWSFGVLLWEIFTLGGSPYPGVPVEELFKL

LKEGHRMDKPSNCTNEL LYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQ - UNI25604 - EYLDLSIPLDQYSPSFPDTRSSTCSSGEDSVF

SHEPLPEEPCLPRHPTQLANSGLKRR
Transcript ENSMUST00000117179
Sequence
CAGCGCTCGGAGCGCTCCTGCGGGTACTTTGGCGGGGCTCTCCGCTGCGGGCGGCGCGGAACGGGAGCCGGAACCCTGGTGCAGCCGCTGCGTGCAGAGG

ACCCGGGCTGCGCAGGGAAGCGGGGCCGAGACGTCCGGACTGGACTGAGACTGTGCTTAGCGCATTGCGGCGACCTCGCCTTTCCCGGCCGCGAGCGCGC

GCCGCAGCTGGAAAAGCAGCGGAGACCGAGGACTTTTCTCAGGTCCCAGGGGCGCACCACAGCCGTGCTGCAGTCAATGCACGCCGGAGCCCCAGGAGGG

GTGATGGAACTCGGGCTGCCAGAAGCCTGAGACGCCGCCACCGCCGCCGCTGCGTACTGGAGAGCGGGGGGCGCACGATCTGGGGACCCCGGGCGGCGGA

CCCGAGCCCTCCCCCCCGCCCCGCCTCCGGGGCACCAGCTTCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCCGGCTCGGAGTGCCGCCGGGAGTCG

TGCCTCGGCCGCGGAGCCCTCGAGACCCCATCAGGATCTGAACGGAGCCCGGAGACGAGCGGCGGGAGCGCAAGACACAGACACCCGCCGCGCCACGGCG

AGCTCTCCAGAGGCGGGACCGCAGCGCCAAGTGAG - UNI30729 - - UNI37959 - AGTCAGCTTGCGAAGGCAGACCACGCTCACGGTGGAAT

ATCCATGGAGGTACGGAGCCTTGTTACCAACCTCTAACCGCAGAACTGGGATGTGGGGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCAC

TCTCTGCACTGCCAGGCCAGCCCCAACCTTGCCTGAACAAG - UNI11247 - - UNI13149 - - UNI14298 - - UNI16727 - CTCAGC

CCTGGGGAGTCCCTGTGGAAGTGGAGTCTCTCCTGGTCCACCCTGGCGACCTGCTACAGCTTCGCTGTCGGCTTCGCGATGATGTGCAGAGCATCAACTG

GCTGCGGGATGGGGTGCAGCTGGTGGAGAGCAACCGTACCCGCATCACAGGGGAGGAGGTGGAGGTGCGGGACTCCATCCCCGCTGACTCTGGCCTCTAC

GCTTGCGTGACCAGCAGCCCCTCTGGCAGCGATACCACCTACTTCTCCGTCAATGTCTCAG - UNI13149 - ATGCACTCCCATCCTCGGAAGATGA

TGACGACGACGATGACTCCTCCTCGGAGGAGAAAGAGACGGACAACACCAAACCAAACC - UNI26903 - CTGTAGCTCCCTACTGGACATCCCCAG

AGAAAATGGAGAAGAAACTGCATGCGGTGCCCGCTGCCAAGACGGTGAAGTTCAAGTGCCCGTCGAGTGGGACACCCAACCCCACTCTGCGCTGGTTGAA

AAATGGCAAAGAGTTTAAGCCTGACCACCGAATTGGAGGCTACAAG - UNI24632 - GTTCGCTATGCCACCTGGAGCATCATAATGGATTCTGTGG

TGCCTTCTGACAAGGGCAACTACACCTGCATCGTGGAGAATGAGTATGGGAGCATCAACCACACCTACCAGCTTGACGTCGTGG AACGATCTCCGCACC

GACCCATCCTTCAGGCAGGGCTGCCTGCCAACAAGACAGTGGCCCTGGGCAGCAATGTGGAGTTCATGTGTAAGGTGTACAGCGATCCGCAGCCTCACAT

TCAGTGGCTGAAGCACATCGAGGTGAACGGGAGTAAGATCGGGCCAGACAACTTGCCGTATGTCCAGATCCTGAAG - UNI11166 - ACTGCTGGAG

TTAATACCACCGACAAGGAAATGGAGGTGCTTCATCTACGGAATGTCTCCTTTGAGGATGCGGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACT

CTCCCATCACTCTGCATGGTTGACCGTTCTGGAAG - UNI33862 - CCCTGGAAGAGAGACCAGCTGTGATGACCTCACCGCTCTACCTGGAGATCA

TTATCTACTGCACCGGGGCCTTCCTGATCTCCTGCATGTTGGGCTCTGTCATCATCTATAAGATGAAGAGCGGCACCAAGAAGAGCGACTTCCATAGCCA

GATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAG TACACT GTGTCAGCTGACTCCAGTGCATCCATGAACTCTGGGGTTCTCCTGG

TTCGGCCCTCACGGCTCTCCTCCAGCGGGACCCCCATGCTGGCTGGAGTCTCCGAATATGAGCTCCCTGAGGATCCCCGCTGGGAGCTGCCACGAGACAG

 - UNI36978 - ACTGGTCTTAGGCAAACCACTTGGCGAGGGCTGCTTCGGGCAGGTGGTGTTGGCTGAGGCCATCGGGCTGGATAAGGACAAACCCA

ACCGTGTGACCAAAGTGGCCGTGAAGATGTTGAAGT CCGACGCAACGGAGAAGGACCTGTCGGATCTGATCTCGGAGATGGAGATGATGAAAATGATTG

GGAAGCACAAGAATATCATCAACCTTCTGGGAGCGTGCACACAGGATG GTCCTCTTTATGTCATTGTGGAGTACGCCTCCAAAGGCAATCTCCGGGAGT

ATCTACAGGCCCGGAGGCCTCCTGGGCTGGAGTACTGCTATAACCCCAGCCACAACCCCGAGGAACAGCTGTCTTCCAAAGATCTGGTATCCTGTGCCTA

TCAGGTGGCTCGGGGCATGGAGTATCTTGCCTCTAAGAAG TGTATACACCGAGACCTGGCTGCTAGGAACGTCCTGGTGACCGAGGATAACGTAATGAA

GATCGCAGACTTTGGCTTAGCTCGAGACATTCATCATATCGACTACTACAAGAAAACCACCAAC GGCCGGCTGCCTGTGAAGTGGATGGCCCCTGAGGC

GTTGTTTGACCGGATCTACACACACCAGAGCGATGT - UNI18351 - GTGGTCTTTTGGAGTGCTCTTGTGGGAGATCTTCACTCTGGGTGGCTCCC

CATACCCCGGTGTGCCTGTGGAGGAACTTTTCAAGCTGCTGAAGGAGGGTCATCGAATGGACAAGCCCAGTAACTGTACCAATGAGCT GTACATGATGA

TGCGGGACTGCTGGCATGCAGTGCCCTCTCAGAGACCTACGTTCAAGCAGTTGGTGGAAGACCTGGACCGCATTGTGGCCTTGACCTCCAACCAG - UN

I25604 - GAGTATCTGGACCTGTCCATACCGCTGGACCAGTACTCACCCAGCTTTCCCGACACACGGAGCTCCACCTGCTCCTCAGGGGAGGACTCTG

TCTTCTCTCATGAGCCGTTACCTGAGGAGCCCTGTCTGCCTCGACACCCCACCCAGCTTGCCAACAGTGGACTCAAACGGCGCTGACTACCAACCCTGTC

CCCAGTTTTCTCCCATTCCGTCGTCACCCGTGCCCCTCACCCACAATCCCCTTGTTGGACACACTGCCTTTCTCCTCCTCCTTTGCCGCTGGCAAGAGCC

AGTGCCTGACTGAGGCCTTCCTGTGTTGTGGCCTTCCCCCTCCATCACCCCCAAGACCCCTCTTCTCCCTCTTCTTAGCCTGCTGTGTGAGAGAGGAGCC

AAGAGGCAGGTGCTTGCCGACGGCCGCATCCTCCTTCCCAGGTGTTGGACCAAGACCCGCCCCGCTGCCTGGCACTGCTTGGAGGTGTGCAGAGCGGAAG

CAAGTGGAGCATCCGGGGCATTCCTGTTGACCCATCAGCCCCTTCTGTTCTGGCGGCAGGGGCCTTGGGGCTCCTGGAAGCCGTGAGGTTTCTGTTTAGG

CCTTAACCGAAGGCAACCTCTGCTCCAGATGGATGGTACCAGTAGCTTCTTAATTCCAATACTAATTTGCTTTGCTGACCAAATACCTGCCTGGTACCAG

AAGACAGGGAGGCAGAGACTGGGAGCCGTGATGTGCCCTTGGGCTGAGCCCTAGACTTGGGGCTCTGTACATAGCTATGAAGAAAAACACAAAGTGTATA

AATCTTGAGTATATATTTACATGTCTTTTTAAAAAGGGTCGTTACTAGAGATTTACCCATGGGGGAGACGCCCAGGGTAGCATCCGTTGCTATATATTAA

AAACAAACGAACAGAAAGAAAAAAAAAAGGAAAATGTTTTTTAAAAGGTCATATATTTTTTTGCTACTTTTGCTGTTTTATTTTTTTAAATTATGTTTTA

AACCTATTTTCAGTTTAGGTTTCCCTCAATAAAAAATTGCTGCTGC
Translation
 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQA - UNI11247 - - UNI13149 - - UNI14298 - - 

UNI16727 - AQPWGVPVEVESLLVHPGDLLQLRCRLRDDVQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVS

D - UNI13149 - DALPSSEDDDDDDDSSSEEKETDNTKPNP - UNI26903 - PVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWL

KNGKEFKPDHRIGGYK - UNI24632 - VRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVE ERSPHRPILQAGLPANKTVALGSNVEF

MCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILK - UNI11166 - TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEA

 - UNI33862 - ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQ YT VSADSSASMNSGVLLV

RPSRLSSSGTPMLAGVSEYELPEDPRWELPRDR - UNI36978 - RLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKS SDATEKDLSD

LISEMEMMKMIGKHKNIINLLGACTQDG GPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKK CIHRDL

AARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTN GRLPVKWMAPEALFDRIYTHQSDV - UNI18351 - VWSFGVLLWEIFTLGGSPYPGVPVEE

LFKLLKEGHRMDKPSNCTNEL LYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQ - UNI25604 - EYLDLSIPLDQYSPSFPDTRSSTCSSGE

DSVFSHEPLPEEPCLPRHPTQLANSGLKRR
Transcript ENSMUST00000118241
Sequence
GCACAGCGCTCGGAGCGCTCCTGCGGGTACTTTGGCGGGGCTCTCCGCTGCGGGCGGCGCGGAACGGGAGCCGGAACCCTGGTGCAGCCGCTGCGTGCAG

AGGACCCGGGCTGCGCAGGGAAGCGGGGCCGAGACGTCCGGACTGGACTGAGACTGTGCTTAGCGCATTGCGGCGACCTCGCCTTTCCCGGCCGCGAGCG

CGCGCCGCAGCTGGAAAAGCAGCGGAGACCGAGGACTTTTCTCAGGTCCCAGGGGCGCACCACAGCCGTGCTGCAGTCAATGCACGCCGGAGCCCCAGGA

GGGGTGATGGAACTCGGGCTGCCAGAAGCCTGAGACGCCGCCACCGCCGCCGCTGCGTACTGGAGAGCGGGGGGCGCACGATCTGGGGACCCCGGGCGGC

GGACCCGAGCCCTCCCCCCCGCCCCGCCTCCGGGGCACCAGCTTCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCCGGCTCGGAGTGCCGCCGGGAG

TCGTGCCTCGGCCGCGGAGCCCTCGAGACCCCATCAGGATCTGAACGGAGCCCGGAGACGAGCGGCGGGAGCGCAAGACACAGACACCCGCCGCGCCACG

GCGAGCTCTCCAGAGGCGGGACCGCAGCGCCAAGTGAG - UNI30729 - - UNI37959 - AGTCAGCTTGCGAAGGCAGACCACGCTCACGGTGG

AATATCCATGGAGGTACGGAGCCTTGTTACCAACCTCTAACCGCAGAACTGGGATGTGGGGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGC

CACTCTCTGCACTGCCAGGCCAGCCCCAACCTTGCCTGAACAAG - UNI11247 - - UNI13149 - - UNI14298 - - UNI16727 - CTC

AGCCCTGGGGAGTCCCTGTGGAAGTGGAGTCTCTCCTGGTCCACCCTGGCGACCTGCTACAGCTTCGCTGTCGGCTTCGCGATGATGTGCAGAGCATCAA

CTGGCTGCGGGATGGGGTGCAGCTGGTGGAGAGCAACCGTACCCGCATCACAGGGGAGGAGGTGGAGGTGCGGGACTCCATCCCCGCTGACTCTGGCCTC

TACGCTTGCGTGACCAGCAGCCCCTCTGGCAGCGATACCACCTACTTCTCCGTCAATGTCTCAG - UNI13149 - ATGCACTCCCATCCTCGGAAGA

TGATGACGACGACGATGACTCCTCCTCGGAGGAGAAAGAGACGGACAACACCAAACCAAACCGTAGGC - UNI26903 - CTGTAGCTCCCTACTGGA

CATCCCCAGAGAAAATGGAGAAGAAACTGCATGCGGTGCCCGCTGCCAAGACGGTGAAGTTCAAGTGCCCGTCGAGTGGGACACCCAACCCCACTCTGCG

CTGGTTGAAAAATGGCAAAGAGTTTAAGCCTGACCACCGAATTGGAGGCTACAAG - UNI24632 - GTTCGCTATGCCACCTGGAGCATCATAATGG

ATTCTGTGGTGCCTTCTGACAAGGGCAACTACACCTGCATCGTGGAGAATGAGTATGGGAGCATCAACCACACCTACCAGCTTGACGTCGTGG AACGAT

CTCCGCACCGACCCATCCTTCAGGCAGGGCTGCCTGCCAACAAGACAGTGGCCCTGGGCAGCAATGTGGAGTTCATGTGTAAGGTGTACAGCGATCCGCA

GCCTCACATTCAGTGGCTGAAGCACATCGAGGTGAACGGGAGTAAGATCGGGCCAGACAACTTGCCGTATGTCCAGATCCTGAAG - UNI11166 - A

CTGCTGGAGTTAATACCACCGACAAGGAAATGGAGGTGCTTCATCTACGGAATGTCTCCTTTGAGGATGCGGGGGAGTATACGTGCTTGGCGGGTAACTC

TATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAG - UNI33862 - CCCTGGAAGAGAGACCAGCTGTGATGACCTCACCGCTCTACC

TGGAGATCATTATCTACTGCACCGGGGCCTTCCTGATCTCCTGCATGTTGGGCTCTGTCATCATCTATAAGATGAAGAGCGGCACCAAGAAGAGCGACTT

CCATAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAG TACACT GTGTCAGCTGACTCCAGTGCATCCATGAACTCTGGGG

TTCTCCTGGTTCGGCCCTCACGGCTCTCCTCCAGCGGGACCCCCATGCTGGCTGGAGTCTCCGAATATGAGCTCCCTGAGGATCCCCGCTGGGAGCTGCC

ACGAGACAG - UNI36978 - ACTGGTCTTAGGCAAACCACTTGGCGAGGGCTGCTTCGGGCAGGTGGTGTTGGCTGAGGCCATCGGGCTGGATAAGG

ACAAACCCAACCGTGTGACCAAAGTGGCCGTGAAGATGTTGAAGT CCGACGCAACGGAGAAGGACCTGTCGGATCTGATCTCGGAGATGGAGATGATGA

AAATGATTGGGAAGCACAAGAATATCATCAACCTTCTGGGAGCGTGCACACAGGATG GTCCTCTTTATGTCATTGTGGAGTACGCCTCCAAAGGCAATC

TCCGGGAGTATCTACAGGCCCGGAGGCCTCCTGGGCTGGAGTACTGCTATAACCCCAGCCACAACCCCGAGGAACAGCTGTCTTCCAAAGATCTGGTATC

CTGTGCCTATCAGGTGGCTCGGGGCATGGAGTATCTTGCCTCTAAGAAG TGTATACACCGAGACCTGGCTGCTAGGAACGTCCTGGTGACCGAGGATAA

CGTAATGAAGATCGCAGACTTTGGCTTAGCTCGAGACATTCATCATATCGACTACTACAAGAAAACCACCAAC GGCCGGCTGCCTGTGAAGTGGATGGC

CCCTGAGGCGTTGTTTGACCGGATCTACACACACCAGAGCGATGT - UNI18351 - GTGGTCTTTTGGAGTGCTCTTGTGGGAGATCTTCACTCTGG

GTGGCTCCCCATACCCCGGTGTGCCTGTGGAGGAACTTTTCAAGCTGCTGAAGGAGGGTCATCGAATGGACAAGCCCAGTAACTGTACCAATGAGCT GT

ACATGATGATGCGGGACTGCTGGCATGCAGTGCCCTCTCAGAGACCTACGTTCAAGCAGTTGGTGGAAGACCTGGACCGCATTGTGGCCTTGACCTCCAA

CCAG - UNI25604 - GAGTATCTGGACCTGTCCATACCGCTGGACCAGTACTCACCCAGCTTTCCCGACACACGGAGCTCCACCTGCTCCTCAGGGG

AGGACTCTGTCTTCTCTCATGAGCCGTTACCTGAGGAGCCCTGTCTGCCTCGACACCCCACCCAGCTTGCCAACAGTGGACTCAAACGGCGCTGACTACC

AACCCTGTCCCCAGTTTTCTCCCATTCCGTCGTCACCCGTGCCCCTCACCCACAATCCCCTTGTTGGACACACTGCCTTTCTCCTCCTCCTTTGCCGCTG

GCAAGAGCCAGTGCCTGACTGAGGCCTTCCTGTGTTGTGGCCTTCCCCCTCCATCACCCCCAAGACCCCTCTTCTCCCTCTTCTTAGCCTGCTGTGTGAG

AGAGGAGCCAAGAGGCAGGTGCTTGCCGACGGCCGCATCCTCCTTCCCAGGTGTTGGACCAAGACCCGCCCCGCTGCCTGGCACTGCTTGGAGGTGTGCA

GAGCGGAAGCAAGTGGAGCATCCGGGGCATTCCTGTTGACCCATCAGCCCCTTCTGTTCTGGCGGCAGGGGCCTTGGGGCTCCTGGAAGCCGTGAGGTTT

CTGTTTAGGCCTTAACCGAAGGCAACCTCTGCTCCAGATGGATGGTACCAGTAGCTTCTTAATTCCAATACTAATTTGCTTTGCTGACCAAATACCTGCC

TGGTACCAGAAGACAGGGAGGCAGAGACTGGGAGCCGTGATGTGCCCTTGGGCTGAGCCCTAGACTTGGGGCTCTGTACATAGCTATGAAGAAAAACACA

AAGTGTATAAATCTTGAGTATATATTTACATGTCTTTTTAAAAAGGGTCGTTACTAGAGATTTACCCATGGGGGAGACGCCCAGGGTAGCATCCGTTGCT

ATATATTAAAAACAAACGAACAGAAAGAAAAAAAAAAGGAAAATGTTTTTTAAAAGGTCATATATTTTTTTGCTACTTTTGCTGTTTTATTTTTTTAAAT

TATGTTTTAAACCTATTTTCAGTTTAGGTTTCCCTCAATAAAAAATTGCTGCTGC
Translation
 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQA - UNI11247 - - UNI13149 - - UNI14298 - - 

UNI16727 - AQPWGVPVEVESLLVHPGDLLQLRCRLRDDVQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVS

D - UNI13149 - DALPSSEDDDDDDDSSSEEKETDNTKPNRRP - UNI26903 - PVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLR

WLKNGKEFKPDHRIGGYK - UNI24632 - VRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVE ERSPHRPILQAGLPANKTVALGSNV

EFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILK - UNI11166 - TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVL

EA - UNI33862 - ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQ YT VSADSSASMNSGVL

LVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDR - UNI36978 - RLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKS SDATEKDL

SDLISEMEMMKMIGKHKNIINLLGACTQDG GPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKK CIHR

DLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTN GRLPVKWMAPEALFDRIYTHQSDV - UNI18351 - VWSFGVLLWEIFTLGGSPYPGVPV

EELFKLLKEGHRMDKPSNCTNEL LYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQ - UNI25604 - EYLDLSIPLDQYSPSFPDTRSSTCSS

GEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR
Transcript ENSMUST00000110623
Sequence
AGCCCTCGCGCCTCGCCGGCGCACAGCGCTCGGAGCGCTCCTGCGGGTACTTTGGCGGGGCTCTCCGCTGCGGGCGGCGCGGAACGGGAGCCGGAACCCT

GGTGCAGCCGCTGCGTGCAGAGGACCCGGGCTGCGCAGGGAAGCGGGGCCGAGACGTCCGGACTGGACTGAGACTGTGCTTAGCGCATTGCGGCGACCTC

GCCTTTCCCGGCCGCGAGCGCGCGCCGCAGCTGGAAAAGCAGCGGAGACCGAGGACTTTTCTCAGGTCCCAGGGGCGCACCACAGCCGTGCTGCAGTCAA

TGCACGCCGGAGCCCCAGGAGGGGTGATGGAACTCGGGCTGCCAGAAGCCTGAGACGCCGCCACCGCCGCCGCTGCGTACTGGAGAGCGGGGGGCGCACG

ATCTGGGGACCCCGGGCGGCGGACCCGAGCCCTCCCCCCCGCCCCGCCTCCGGGGCACCAGCTTCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCCG

GCTCGGAGTGCCGCCGGGAGTCGTGCCTCGGCCGCGGAGCCCTCGAGACCCCATCAGGATCTGAACGGAGCCCGGAGACGAGCGGCGGGAGCGCAAGACA

CAGACACCCGCCGCGCCACGGCGAGCTCTCCAGAGGCGGGACCGCAGCGCCAAGTGAG - UNI30729 - - UNI37959 - AGTCAGCTTGCGAAG

GCAGACCACGCTCACGGTGGAATATCCATGGAGGTACGGAGCCTTGTTACCAACCTCTAACCGCAGAACTGGGATGTGGGGCTGGAAGTGCCTCCTCTTC

TGGGCTGTGCTGGTCACAGCCACTCTCTGCACTGCCAGGCCAGCCCCAACCTTGCCTGAACAAG - UNI11247 - - UNI13149 - - UNI1429

8 - - UNI16727 - ATGCACTCCCATCCTCGGAAGATGATGACGACGACGATGACTCCTCCTCGGAGGAGAAAGAGACGGACAACACCAAACCAAAC

CGTAGGC - UNI26903 - CTGTAGCTCCCTACTGGACATCCCCAGAGAAAATGGAGAAGAAACTGCATGCGGTGCCCGCTGCCAAGACGGTGAAGTT

CAAGTGCCCGTCGAGTGGGACACCCAACCCCACTCTGCGCTGGTTGAAAAATGGCAAAGAGTTTAAGCCTGACCACCGAATTGGAGGCTACAAG - UNI

24632 - GTTCGCTATGCCACCTGGAGCATCATAATGGATTCTGTGGTGCCTTCTGACAAGGGCAACTACACCTGCATCGTGGAGAATGAGTATGGGAG

CATCAACCACACCTACCAGCTTGACGTCGTGG AACGATCTCCGCACCGACCCATCCTTCAGGCAGGGCTGCCTGCCAACAAGACAGTGGCCCTGGGCAG

CAATGTGGAGTTCATGTGTAAGGTGTACAGCGATCCGCAGCCTCACATTCAGTGGCTGAAGCACATCGAGGTGAACGGGAGTAAGATCGGGCCAGACAAC

TTGCCGTATGTCCAGATCCTGAAG - UNI11166 - ACTGCTGGAGTTAATACCACCGACAAGGAAATGGAGGTGCTTCATCTACGGAATGTCTCCTT

TGAGGATGCGGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAG - UNI33862 - CCC

TGGAAGAGAGACCAGCTGTGATGACCTCACCGCTCTACCTGGAGATCATTATCTACTGCACCGGGGCCTTCCTGATCTCCTGCATGTTGGGCTCTGTCAT

CATCTATAAGATGAAGAGCGGCACCAAGAAGAGCGACTTCCATAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACA

 GTGTCAGCTGACTCCAGTGCATCCATGAACTCTGGGGTTCTCCTGGTTCGGCCCTCACGGCTCTCCTCCAGCGGGACCCCCATGCTGGCTGGAGTCTCC

GAATATGAGCTCCCTGAGGATCCCCGCTGGGAGCTGCCACGAGACAG - UNI36978 - ACTGGTCTTAGGCAAACCACTTGGCGAGGGCTGCTTCGG

GCAGGTGGTGTTGGCTGAGGCCATCGGGCTGGATAAGGACAAACCCAACCGTGTGACCAAAGTGGCCGTGAAGATGTTGAAGT CCGACGCAACGGAGAA

GGACCTGTCGGATCTGATCTCGGAGATGGAGATGATGAAAATGATTGGGAAGCACAAGAATATCATCAACCTTCTGGGAGCGTGCACACAGGATG GTCC

TCTTTATGTCATTGTGGAGTACGCCTCCAAAGGCAATCTCCGGGAGTATCTACAGGCCCGGAGGCCTCCTGGGCTGGAGTACTGCTATAACCCCAGCCAC

AACCCCGAGGAACAGCTGTCTTCCAAAGATCTGGTATCCTGTGCCTATCAGGTGGCTCGGGGCATGGAGTATCTTGCCTCTAAGAAG TGTATACACCGA

GACCTGGCTGCTAGGAACGTCCTGGTGACCGAGGATAACGTAATGAAGATCGCAGACTTTGGCTTAGCTCGAGACATTCATCATATCGACTACTACAAGA

AAACCACCAAC GGCCGGCTGCCTGTGAAGTGGATGGCCCCTGAGGCGTTGTTTGACCGGATCTACACACACCAGAGCGATGT - UNI18351 - GTG

GTCTTTTGGAGTGCTCTTGTGGGAGATCTTCACTCTGGGTGGCTCCCCATACCCCGGTGTGCCTGTGGAGGAACTTTTCAAGCTGCTGAAGGAGGGTCAT

CGAATGGACAAGCCCAGTAACTGTACCAATGAGCT GTACATGATGATGCGGGACTGCTGGCATGCAGTGCCCTCTCAGAGACCTACGTTCAAGCAGTTG

GTGGAAGACCTGGACCGCATTGTGGCCTTGACCTCCAACCAG - UNI25604 - GAGTATCTGGACCTGTCCATACCGCTGGACCAGTACTCACCCAG

CTTTCCCGACACACGGAGCTCCACCTGCTCCTCAGGGGAGGACTCTGTCTTCTCTCATGAGCCGTTACCTGAGGAGCCCTGTCTGCCTCGACACCCCACC

CAGCTTGCCAACAGTGGACTCAAACGGCGCTGACTACCAACCCTGTCCCCAGTTTTCTCCCATTCCGTCGTCACCCGTGCCCCTCACCCACAATCCCCTT

GTTGGACACACTGCCTTTCTCCTCCTCCTTTGCCGCTGGCAAGAGCCAGTGCCTGACTGAGGCCTTCCTGTGTTGTGGCCTTCCCCCTCCATCACCCCCA

AGACCCCTCTTCTCCCTCTTCTTAGCCTGCTGTGTGAGAGAGGAGCCAAGAGGCAGGTGCTTGCCGACGGCCGCATCCTCCTTCCCAGGTGTTGGACCAA

GACCCGCCCCGCTGCCTGGCACTGCTTGGAGGTGTGCAGAGCGGAAGCAAGTGGAGCATCCGGGGCATTCCTGTTGACCCATCAGCCCCTTCTGTTCTGG

CGGCAGGGGCCTTGGGGCTCCTGGAAGCCGTGAGGTTTCTGTTTAGGCCTTAACCGAAGGCAACCTCTGCTCCAGATGGATGGTACCAGTAGCTTCTTAA

TTCCAATACTAATTTGCTTTGCTGACCAAATACCTGCCTGGTACCAGAAGACAGGGAGGCAGAGACTGGGAGCCGTGATGTGCCCTTGGGCTGAGCCCTA

GACTTGGGGCTCTGTACATAGCTATGAAGAAAAACACAAAGTGTATAAATCTTGAGTATATATTTACATGTCTTTTTAAAAAGGGTCGTTACTAGAGATT

TACCCATGGGGGAGACGCCCAGGGTAGCATCCGTTGCTATATATTAAAAACAAACGAACAGAAAGAAAAAAAAAAGGAAAATGTTTTTTAAAAGGTCATA

TATTTTTTTGCTACTTTTGCTGTTTTATTTTTTTAAATTATGTTTTAAACCTATTTTCAGTTTAGGTTTCCCTCAATAAAAAATTGCTGCTGCTTCATTT

TTATCCTGGGCGTGTGAAAAGAGAGCAGGTGTCCAGCGCAGAGGAGGGAGACAGGGGGTAAAGGGCCATGAGCTGGTCTTCCCCCTGCCCCCCATGACCT

CTGTCTCCTGGATTGTGCCCCAGACCTCCCAGCCAAGCCTTCTATCTCCCGATGCATTGGGAACAGCAGGAGAAGACTGAGGTCCTGAGGGCAGAGAGCC

AAGCTCGCACACTTGATTGTTTCCTCGGAGGAGAGAGTGAGAGGATGAGGTTAGCCAGAGGGTAGAACTGGACAGAAACCCAAACCCTAGACCCTGTACA

TTCAGATGTCTTGTCTATCTTCCCCAACCTACTCCTCATATTCCTCTCCTGTAAATATCCTCCCCTTCCCTGTTGGTCTCTGTTACCCAGTTGGGTCTGT

CCCTGAGCTTGGCTTCCTATAGTTTTTCCTTCACAAACTCCACCCATCCCTCAGGAAACAGAAAACGATCTCTTTGGTTGGGGTCAACTTGGCAACTCAA

TTCTGCCACCTGCTGGTTGCTTTGGTACCTTGGTCTCTTATTCAAACCCACACCACTCAAGCCTTAGAGGGTTTGTTTTTGTTTTTTGTTTGTTTGTTTG

GTTGGTTGGTTGGTCTTTTTTTTCTGGGTCTGCTGAATACAAACCTGTTCAGTATGATTTCATCTGTAGGGGTTAGGGCTGCTTCTTTAAATGCAGTTTT

GGCAGCTGTGGTTTGGGTCATTGTCATAAGAGTTCTTATCGTTGTTTCTCTCTGTACACATGTAACTGTCAAAATATTATGAATGGTTTTTATGCTGAAA

GAAGACATCATTTGGCAAAGAGGGCTAGGGAATGAATTTAGCACAAACTCATTTTCTTGGAGACCGTGTATCATAGTGGTTTTTTTTTTTTTTCTTTCTC

TTGTTAAAACTGAACATTATTTCTGC
Translation
 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQD - UNI11247 - - UNI13149 - - UNI14298 - - 

UNI16727 - DALPSSEDDDDDDDSSSEEKETDNTKPNRRP - UNI26903 - PVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKN

GKEFKPDHRIGGYK - UNI24632 - VRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVE ERSPHRPILQAGLPANKTVALGSNVEFMC

KVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILK - UNI11166 - TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEA -

 UNI33862 - ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVT VSADSSASMNSGVLLVRPS

RLSSSGTPMLAGVSEYELPEDPRWELPRDR - UNI36978 - RLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKS SDATEKDLSDLIS

EMEMMKMIGKHKNIINLLGACTQDG GPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKK CIHRDLAAR

NVLVTEDNVMKIADFGLARDIHHIDYYKKTTN GRLPVKWMAPEALFDRIYTHQSDV - UNI18351 - VWSFGVLLWEIFTLGGSPYPGVPVEELFK

LLKEGHRMDKPSNCTNEL LYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQ - UNI25604 - EYLDLSIPLDQYSPSFPDTRSSTCSSGEDSV

FSHEPLPEEPCLPRHPTQLANSGLKRR
Transcript ENSMUST00000084027
Sequence
AGCCCTCGCGCCTCGCCGGCGCACAGCGCTCGGAGCGCTCCTGCGGGTACTTTGGCGGGGCTCTCCGCTGCGGGCGGCGCGGAACGGGAGCCGGAACCCT

GGTGCAGCCGCTGCGTGCAGAGGACCCGGGCTGCGCAGGGAAGCGGGGCCGAGACGTCCGGACTGGACTGAGACTGTGCTTAGCGCATTGCGGCGACCTC

GCCTTTCCCGGCCGCGAGCGCGCGCCGCAGCTGGAAAAGCAGCGGAGACCGAGGACTTTTCTCAGGTCCCAGGGGCGCACCACAGCCGTGCTGCAGTCAA

TGCACGCCGGAGCCCCAGGAGGGGTGATGGAACTCGGGCTGCCAGAAGCCTGAGACGCCGCCACCGCCGCCGCTGCGTACTGGAGAGCGGGGGGCGCACG

ATCTGGGGACCCCGGGCGGCGGACCCGAGCCCTCCCCCCCGCCCCGCCTCCGGGGCACCAGCTTCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCCG

GCTCGGAGTGCCGCCGGGAGTCGTGCCTCGGCCGCGGAGCCCTCGAGACCCCATCAGGATCTGAACGGAGCCCGGAGACGAGCGGCGGGAGCGCAAGACA

CAGACACCCGCCGCGCCACGGCGAGCTCTCCAGAGGCGGGACCGCAGCGCCAAGTGAG - UNI30729 - - UNI37959 - AGTCAGCTTGCGAAG

GCAGACCACGCTCACGGTGGAATATCCATGGAGGTACGGAGCCTTGTTACCAACCTCTAACCGCAGAACTGGGATGTGGGGCTGGAAGTGCCTCCTCTTC

TGGGCTGTGCTGGTCACAGCCACTCTCTGCACTGCCAGGCCAGCCCCAACCTTGCCTGAACAAG - UNI11247 - - UNI14298 - - UNI1672

7 - GCTCTTCCTCCTGGCCCTTGTGGGTGGCTGCTGCAGCTCAGCCCTGGGGAGTCCCTGTGGAAGTGGAGTCTCTCCTGGTCCACCCTGGCGACCTGC

TACAGCTTCGCTGTCGGCTTCGCGATGATGTGCAGAGCATCAACTGGCTGCGGGATGGGGTGCAGCTGGTGGAGAGCAACCGTACCCGCATCACAGGGGA

GGAGGTGGAGGTGCGGGACTCCATCCCCGCTGACTCTGGCCTCTACGCTTGCGTGACCAGCAGCCCCTCTGGCAGCGATACCACCTACTTCTCCGTCAAT

GTCTCAG - UNI13149 - ATGCACTCCCATCCTCGGAAGATGATGACGACGACGATGACTCCTCCTCGGAGGAGAAAGAGACGGACAACACCAAACC

AAACC - UNI26903 - CTGTAGCTCCCTACTGGACATCCCCAGAGAAAATGGAGAAGAAACTGCATGCGGTGCCCGCTGCCAAGACGGTGAAGTTCA

AGTGCCCGTCGAGTGGGACACCCAACCCCACTCTGCGCTGGTTGAAAAATGGCAAAGAGTTTAAGCCTGACCACCGAATTGGAGGCTACAAG - UNI24

632 - GTTCGCTATGCCACCTGGAGCATCATAATGGATTCTGTGGTGCCTTCTGACAAGGGCAACTACACCTGCATCGTGGAGAATGAGTATGGGAGCA

TCAACCACACCTACCAGCTTGACGTCGTGG AACGATCTCCGCACCGACCCATCCTTCAGGCAGGGCTGCCTGCCAACAAGACAGTGGCCCTGGGCAGCA

ATGTGGAGTTCATGTGTAAGGTGTACAGCGATCCGCAGCCTCACATTCAGTGGCTGAAGCACATCGAGGTGAACGGGAGTAAGATCGGGCCAGACAACTT

GCCGTATGTCCAGATCCTGAAG - UNI11166 - ACTGCTGGAGTTAATACCACCGACAAGGAAATGGAGGTGCTTCATCTACGGAATGTCTCCTTTG

AGGATGCGGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAG - UNI33862 - CCCTG

GAAGAGAGACCAGCTGTGATGACCTCACCGCTCTACCTGGAGATCATTATCTACTGCACCGGGGCCTTCCTGATCTCCTGCATGTTGGGCTCTGTCATCA

TCTATAAGATGAAGAGCGGCACCAAGAAGAGCGACTTCCATAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACA G

TGTCAGCTGACTCCAGTGCATCCATGAACTCTGGGGTTCTCCTGGTTCGGCCCTCACGGCTCTCCTCCAGCGGGACCCCCATGCTGGCTGGAGTCTCCGA

ATATGAGCTCCCTGAGGATCCCCGCTGGGAGCTGCCACGAGACAG - UNI36978 - ACTGGTCTTAGGCAAACCACTTGGCGAGGGCTGCTTCGGGC

AGGTGGTGTTGGCTGAGGCCATCGGGCTGGATAAGGACAAACCCAACCGTGTGACCAAAGTGGCCGTGAAGATGTTGAAGT CCGACGCAACGGAGAAGG

ACCTGTCGGATCTGATCTCGGAGATGGAGATGATGAAAATGATTGGGAAGCACAAGAATATCATCAACCTTCTGGGAGCGTGCACACAGGATG GTCCTC

TTTATGTCATTGTGGAGTACGCCTCCAAAGGCAATCTCCGGGAGTATCTACAGGCCCGGAGGCCTCCTGGGCTGGAGTACTGCTATAACCCCAGCCACAA

CCCCGAGGAACAGCTGTCTTCCAAAGATCTGGTATCCTGTGCCTATCAGGTGGCTCGGGGCATGGAGTATCTTGCCTCTAAGAAG TGTATACACCGAGA

CCTGGCTGCTAGGAACGTCCTGGTGACCGAGGATAACGTAATGAAGATCGCAGACTTTGGCTTAGCTCGAGACATTCATCATATCGACTACTACAAGAAA

ACCACCAAC GGCCGGCTGCCTGTGAAGTGGATGGCCCCTGAGGCGTTGTTTGACCGGATCTACACACACCAGAGCGATGT - UNI18351 - GTGGT

CTTTTGGAGTGCTCTTGTGGGAGATCTTCACTCTGGGTGGCTCCCCATACCCCGGTGTGCCTGTGGAGGAACTTTTCAAGCTGCTGAAGGAGGGTCATCG

AATGGACAAGCCCAGTAACTGTACCAATGAGCT GTACATGATGATGCGGGACTGCTGGCATGCAGTGCCCTCTCAGAGACCTACGTTCAAGCAGTTGGT

GGAAGACCTGGACCGCATTGTGGCCTTGACCTCCAACCAG - UNI25604 - GAGTATCTGGACCTGTCCATACCGCTGGACCAGTACTCACCCAGCT

TTCCCGACACACGGAGCTCCACCTGCTCCTCAGGGGAGGACTCTGTCTTCTCTCATGAGCCGTTACCTGAGGAGCCCTGTCTGCCTCGACACCCCACCCA

GCTTGCCAACAGTGGACTCAAACGGCGCTGACTACCAACCCTGTCCCCAGTTTTCTCCCATTCCGTCGTCACCCGTGCCCCTCACCCACAATCCCCTTGT

TGGACACACTGCCTTTCTCCTCCTCCTTTGCCGCTGGCAAGAGCCAGTGCCTGACTGAGGCCTTCCTGTGTTGTGGCCTTCCCCCTCCATCACCCCCAAG

ACCCCTCTTCTCCCTCTTCTTAGCCTGCTGTGTGAGAGAGGAGCCAAGAGGCAGGTGCTTGCCGACGGCCGCATCCTCCTTCCCAGGTGTTGGACCAAGA

CCCGCCCCGCTGCCTGGCACTGCTTGGAGGTGTGCAGAGCGGAAGCAAGTGGAGCATCCGGGGCATTCCTGTTGACCCATCAGCCCCTTCTGTTCTGGCG

GCAGGGGCCTTGGGGCTCCTGGAAGCCGTGAGGTTTCTGTTTAGGCCTTAACCGAAGGCAACCTCTGCTCCAGATGGATGGTACCAGTAGCTTCTTAATT

CCAATACTAATTTGCTTTGCTGACCAAATACCTGCCTGGTACCAGAAGACAGGGAGGCAGAGACTGGGAGCCGTGATGTGCCCTTGGGCTGAGCCCTAGA

CTTGGGGCTCTGTACATAGCTATGAAGAAAAACACAAAGTGTATAAATCTTGAGTATATATTTACATGTCTTTTTAAAAAGGGTCGTTACTAGAGATTTA

CCCATGGGGGAGACGCCCAGGGTAGCATCCGTTGCTATATATTAAAAACAAACGAACAGAAAGAAAAAAAAAAGGAAAATGTTTTTTAAAAGGTCATATA

TTTTTTTGCTACTTTTGCTGTTTTATTTTTTTAAATTATGTTTTAAACCTATTTTCAGTTTAGGTTTCCCTCAATAAAAAATTGCTGCTGCTTCATTTTT

ATCCTGGGCGTGTGAAAAGAGAGCAGGTGTCCAGCGCAGAGGAGGGAGACAGGGGGTAAAGGGCCATGAGCTGGTCTTCCCCCTGCCCCCCATGACCTCT

GTCTCCTGGATTGTGCCCCAGACCTCCCAGCCAAGCCTTCTATCTCCCGATGCATTGGGAACAGCAGGAGAAGACTGAGGTCCTGAGGGCAGAGAGCCAA

GCTCGCACACTTGATTGTTTCCTCGGAGGAGAGAGTGAGAGGATGAGGTTAGCCAGAGGGTAGAACTGGACAGAAACCCAAACCCTAGACCCTGTACATT

CAGATGTCTTGTCTATCTTCCCCAACCTACTCCTCATATTCCTCTCCTGTAAATATCCTCCCCTTCCCTGTTGGTCTCTGTTACCCAGTTGGGTCTGTCC

CTGAGCTTGGCTTCCTATAGTTTTTCCTTCACAAACTCCACCCATCCCTCAGGAAACAGAAAACGATCTCTTTGGTTGGGGTCAACTTGGCAACTCAATT

CTGCCACCTGCTGGTTGCTTTGGTACCTTGGTCTCTTATTCAAACCCACACCACTCAAGCCTTAGAGGGTTTGTTTTTGTTTTTTGTTTGTTTGTTTGGT

TGGTTGGTTGGTCTTTTTTTTCTGGGTCTGCTGAATACAAACCTGTTCAGTATGATTTCATCTGTAGGGGTTAGGGCTGCTTCTTTAAATGCAGTTTTGG

CAGCTGTGGTTTGGGTCATTGTCATAAGAGTTCTTATCGTTGTTTCTCTCTGTACACATGTAACTGTCAAAATATTATGAATGGTTTTTATGCTGAAAGA

AGACATCATTTGGCAAAGAGGGCTAGGGAATGAATTTAGCACAAACTCATTTTCTTGGAGACCGTGTATCATAGTGGTTTTTTTTTTTTTTCTTTCTCTT

GTTAAAACTGAACATTATTTCTGC
Translation
 - UNI30729 - - UNI37959 - MWGWKCLLFWAVLVTATLCTARPAPTLPEQG - UNI11247 - - UNI14298 - - UNI16727 - GS

SSWPLWVAAAAQPWGVPVEVESLLVHPGDLLQLRCRLRDDVQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSD

 - UNI13149 - DALPSSEDDDDDDDSSSEEKETDNTKPNP - UNI26903 - PVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLK

NGKEFKPDHRIGGYK - UNI24632 - VRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVE ERSPHRPILQAGLPANKTVALGSNVEFM

CKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILK - UNI11166 - TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEA 

- UNI33862 - ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVT VSADSSASMNSGVLLVRP

SRLSSSGTPMLAGVSEYELPEDPRWELPRDR - UNI36978 - RLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKS SDATEKDLSDLI

SEMEMMKMIGKHKNIINLLGACTQDG GPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKK CIHRDLAA

RNVLVTEDNVMKIADFGLARDIHHIDYYKKTTN GRLPVKWMAPEALFDRIYTHQSDV - UNI18351 - VWSFGVLLWEIFTLGGSPYPGVPVEELF

KLLKEGHRMDKPSNCTNEL LYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQ - UNI25604 - EYLDLSIPLDQYSPSFPDTRSSTCSSGEDS

VFSHEPLPEEPCLPRHPTQLANSGLKRR

For any suggestions or comments, please send an email to unitrap@crg.es