Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031605 (Klhl2)
Chromosomal location
Chr 8: 67218660 - 67373716 (-)
Description
kelch-like 2, Mayven (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:1924363]
RefSeq_peptide
NP_848748.2 
UniGene
Mm.395662 Mm.476038 
MGI
MGI:1924363 
Uniprot/SWISSPROT
Q8JZP3 
Uniprot/SPTREMBL
Q5DTF0 
Human Ortholog
ENSG00000109466 (KLHL2)
Omim not available
UniTrap UNI18522
Vector Insertion
Chr 8: 67358468 - 67373530
Public Clones IST12974B12 (tigm)
Private Clones OST421581 (lexicon) OST396378 (lexicon) OST209753 (lexicon) OST44695 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6659
Vector Insertion
Chr 8: 67243030 - 67258494
Public Clones RHA343 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9120
Vector Insertion
Chr 8: 67238647 - 67242919
Public Clones XK597 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7950
Vector Insertion
Chr 8: 67233200 - 67236888
Public Clones RRJ583 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034017
Sequence
GGGGCCGCCGCCGCAGGTGGTGGCGCGCGGTGAGGAGCGCTGCGCCCCCTCGGGGCGGATGGAACGGGGCTGGGCGGGCGGACAGTGCCGGCGTCCGCGG

CTGGTATGGTGCTGGCGGCGGCGGTCGCTGCCTGCGTTCTGAAGCCCGCGAGGAGCCACAATGGAGACGCCGCCACTGCCTCCCGC - UNI18522 - 

ATGCACAAAGCAGGGTCATCAGAAGCCCCTCGATTCAAAAGACGAGAATCCTGAGAAACATTGCCCACTGACGGTGAACCCCTGGCACATGAAGAAAGCC

TTTAAAGTCATGAACGAACTCAGAAG TCAAAATCTGCTGTGTGACGTCACGATTGTGGCAGAAGACATGGAGATCCCTGCTCACCGCGTGGTGCTGGCG

GCCTGCAGTCCGTACTTCCACGCCATGTTTACAG GTGAGATGAGCGAGAGCCGAGCAAAGAGAGTTCGAATAAAGGAGGTGGACGGCTGGACCCTGAGG

ATGCTGGTCGATTACGTTTACACGGCAGAGATTCAGGTCACAGAGGAGAACGTGCAG GTCCTCCTCCCAGCAGCTGGCCTGCTACAGTTACAGGATGTG

AAGAAGACATGCTGTGAATTTTTAGAATCCCAGCTTCACCCTGTCAACTGCTTAGGAATCCGGGCTTTTGCTGATATGCATGCATGCACAGACCTCCTGA

ATAAGGCCAACACGTATGCAG - UNI6659 - AACAACATTTTGCAGATGTCGTACTTAGTGAAGAGTTTCTTAACCTCGGCATCGAGCAGGTGTGCA

GCTTAATCTCCAGTGATAAACTCACCATTTCCTCCGAGGAGAAG - UNI9120 - GTATTTGAAGCAGTCATCGCCTGGGTAAACCACGATAAGGACG

TAAGACAGGAGTTCATGGCTCGGCTCATGGAGCATGTCCGATTACCTCTGCTTCCTCGGGAGTACTTGGTGCAG CGGGTTGAAGAGGAAGCATTGGTGA

AGAACAGCAGTGCGTGCAAAGATTACCTCATTGAAGCCATGAAGTACCACCTGCTGCCGACAGAGCAGCGCATGTTAATGAAGAGCGTGCGGACCCGCCT

GAGGACGCCCATGAACCTTCCCAAA - UNI7950 - TTGATGGTGGTGGTCGGGGGCCAGGCACCAAAGGCTATCCGAAGTGTGGAATGCTACGACTT

CAAAGAAGAACGGTGGCACCAGGTGGCAGAGCTGCCTTCCAGGAGGTGCAGGGCAG GGATGGTCTATATGGCTGGGCTGGTCTTTGCTGTTGGTGGCTT

CAATGGCTCACTAAGAGTTCGCACTGTAGATTCCTATGACCCCGTGAAAGACCAGTGGACCAGCGTGGCGAACATGCGAGACCGAAGAAGCACACTTGGA

GCCGCGGTGCTGAATGGGCTGCTGTACGCCGTGGGGGGCTTTGACGGCAGCACAG GTCTATCGTCTGTGGAAGCATACAACATAAAATCTAATGAGTGG

TTTCATGTCGCCCCAATGAACACGAGGAGGAGCAGTGTGGGTGTTGGCGTTGTTGGAG GTTTGCTCTATGCCGTGGGGGGTTACGATGGAGCATCGCGC

CAGTGTCTTAGCACAGTAGAATGCTATAATGCTACTGCAAACGAGTGGACTTACATAGCAGAAATGAGCACCAGACGGAGCGGAGCAG GTGTTGGTGTG

TTAAACAACTTATTATATGCTGTAGGAGGTCATGATGGTCCTTTAGTACGAAAAAGTGTTGAAGTATATGACCCCACCACAAATGCCTGGAGACAGGTTG

CAGATATGAACATGTGCAGAAGAAATGCAG GTGTCTGTGCAGTTAATGGTCTGTTGTATGTTGTCGGAGGAGATGATGGTTCCTGTAACTTGGCGTCGG

TAGAGTATTATAACCCCACCACGGATAAATGGACAGTTGTGTCCTCTTGTATGAGCACGGGGAGAAGCTACGCAG GGGTCACAGTTATTGATAAACCGT

TATGAGCCTGAAGGACATTTTCAGCGTATCATTCCATGAGAACCAGGCGTCCACAAGTATTTCTGAAGGGACTGAGCGCCTGGCCTCTCCACTTGTAGCC

GCACTTTACGTCTCAGCAGAAGATGAGACCATCTGCCTTCAGAGGCCTCGGATACTGAAGATTATTTTTGGTAGAAGCACTGTGTAGGCTTTCTCTGCAC

CGAGCAGCAGCTGACTGACTTTACAAGAGACCTAGACTGCAGTCCCTCCACTGTGGTCTTTAGGCAACAGTCGCTTTCATAAAAACTAGTTCTTATCAGC

CTCGAATGACTATGGATTATTTTGTGAAAGAGAATAAAGTTAACGTGTGTTCTTGTAAAATTAAGTTTTATCTTTATTCTTTCTCCTGAAAAATCTCCTG

GGAACAGAGAATCTTTGGAGCAGATTAAAATCTATGTAAGTATATGACACTGTTGAGGGGTGAAACTGCTGGCTTTTATAAGTATCTTTGATTACATGAC

TATAATAAATTGTGTGCATATAAATGTGTGTCTATATGCTTTCCTTTAAATATGTTTGAAAAGATGTTTGATTATCTATTTATAATTGGCACAGTACTTT

GAATTATGCCAGTACTACATTGTAAAACAGAGTTGTATTTTTTGATATTTAACAATGCTGAACACTTTAAAAAACGCCACTTCTGAGGAATGAATGAACA

TGGCGTAACACACTTTAATATGTGTGATGCCAAACTTTTTTAAATAAAATATAAATTATGCTTATTTATTATTTTTTTCTTTAGTTTAATCTTGATCATG

TTTTGGTGTGTGTTTTTAATTTTTTTTCTTAAAGTAACACTTTTGGCATGAACATACCTGCAGGTTTTTTGATGAATATAATGAATGTGTGGAATTCAAC

TGAATTTGCATGGTCTTAAGAATTTTTTCTGTGTGTATAAATTTAGCTGCTATTAATGGAAGAGAAAGCTTTCTGTGACTAATCATGTGTATTGAGCAGA

TAGTTTTTCTGAGATCTTCGATTAATCTCTTTAAAGATGACCAACATGTGTCTTTCTTGAATTATCTTTGAATAAAAGTTTGTATATT
Translation
METPPLPPA - UNI18522 - ACTKQGHQKPLDSKDENPEKHCPLTVNPWHMKKAFKVMNELRS SQNLLCDVTIVAEDMEIPAHRVVLAACSPYFHA

MFTG GEMSESRAKRVRIKEVDGWTLRMLVDYVYTAEIQVTEENVQ VLLPAAGLLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTY

AE - UNI6659 - EQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEK - UNI9120 - VFEAVIAWVNHDKDVRQEFMARLMEHVRLPLLPRE

YLVQ RVEEEALVKNSSACKDYLIEAMKYHLLPTEQRMLMKSVRTRLRTPMNLPK - UNI7950 - LMVVVGGQAPKAIRSVECYDFKEERWHQVAEL

PSRRCRAG GMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTG GLSSVEAYNIKSNEWFHVAPMNT

RRSSVGVGVVGG GLLYAVGGYDGASRQCLSTVECYNATANEWTYIAEMSTRRSGAG GVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNM

CRRNAG GVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAG GVTVIDKPL

For any suggestions or comments, please send an email to unitrap@crg.es