Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031616 (Ednra)
Chromosomal location
Chr 8: 80186928 - 80248351 (-)
Description
endothelin receptor type A Gene [Source:MGI (curated);Acc:Ednra-001]
RefSeq_dna
NM_010332 
RefSeq_peptide
NP_034462.1 
UniGene
Mm.283168 
MGI
MGI:105923 
Uniprot/SWISSPROT
Q61614 
Human Ortholog
ENSG00000151617 (EDNRA)
Omim not available
UniTrap UNI32129
Vector Insertion
Chr 8: 80212967 - 80244402
Public Clones IST14307D1 (tigm) IST12129C8 (tigm) IST11461C2 (tigm) IST10599E3 (tigm)
IST13232G8 (tigm) IST10478H1 (tigm) IST14997C12 (tigm) IST10709B5 (tigm)
IST14156B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14197
Vector Insertion
Chr 8: 80199011 - 80212967
Public Clones CMHD-GT_76F12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034029
Sequence
CAGAGTAGAGAGGAAGGTCTAGGAGCCTGTGGAGTCTAAGGAAGATCGCGGGAGGCGTGTTCCTCCGGAGTTTGCTTTTCCTTGGGAGCCTCGCGCGCAC

ACCCATCCCTTCTAGTCTGGCAACTGTGTCTAGGAGGTGGGGAGCCTCTCTCTGATCCACCGGACCATCGCTGGAGCTTGCAGGCTGAGCAAGATCTCCC

CCTAGAGAAGCCTGGCTGTCCGGGGAAGTTTCCCCGAGCTGAGACTGTGCTGCAGCCCTGGTCACCCGCCACCCTGCGCGCCACCCTCGTTCTCCAGCTC

AGGCTCCGGCTGGCCCGTGCGCGGACCTGGAGCTGTCTGCTTCCGAGGAGCTCTAAG - UNI32129 - GTGAAAAAAAGAAAGGCGTGAGACCAACA

TAAGAAGACTTAAAATCCAGGTTAAGATGAGTATCTTTTGCCTTGCGGCATACTTTTGGCTGACCATGGTGGGAGGCGTAATGGCTGACAATCCGGAGAG

ATACAGCGCTAATCTAAGCAGCCACATGGAAGACTTCACCCCTTTTCCGGGGACGGAGATCAACTTTCTGGGCACCACCCATCGACCCCCTAATTTGGCC

CTGCCTAGCAATGGCTCAATGCACGGCTATTGCCCACAGCAGACTAAAATCACGACAGCTTTCAAATATATTAACACTGTGATATCCTGCACCATTTTCA

TCGTGGGAATGGTGGGGAACGCAACTCTACTACGAATCATTTACCAAAACAAGTGTATGAGGAACGGCCCCAATGCGCTCATAGCCAGCCTGGCCCTTGG

AGACCTTATCTACGTGGTCATTGACCTCCCCATCAACGTGTTTAAG - UNI32129 - CTCTTGGCAGGACGCTGGCCTTTCGACCACAATGATTTTG

GAGTGTTTCTCTGCAAGCTGTTCCCCTTCCTGCAGAAGTCCTCCGTGGGCATCACCGTCTTGAACCTCTGTGCTCTCAGTGTGGACAG - UNI14197 

- - UNI32129 - GTACAGAGCAGTGGCTTCCTGGAGCCGAGTTCAAGGAATCGGGATCCCCTTGATTACCGCCATTGAAATCGTCTCCATCTGGATT

CTTTCCTTCATCTTGGCCATCCCGGAAGCAATCGGCTTCGTCATGGTACCCTTCGAATACAAGGGCGAGCTGCATAGGACCTGCATGCTCAACGCCACGT

CCAAGTTCATGGAG TTTTACCAAGATGTGAAGGACTGGTGGCTCTTTGGGTTCTACTTCTGCATGCCCTTGGTGTGCACAGCAATCTTCTACACCCTCA

TGACCTGTGAGATGCTCAACAGGAGGAACGGCAGCTTGCGGATCGCCCTTAGTGAGCACCTCAAACAG CGTCGAGAAGTGGCAAAGACTGTCTTCTGCT

TGGTTGTCATCTTCGCCCTGTGCTGGTTCCCTCTTCACTTAAGCCGCATTTTGAAGAAAACTGTATATGATGAGATGGATAAGAACCGGTGTGAACTGCT

CAG CTTCTTGCTGCTAATGGATTACATCGGCATTAACCTGGCAACCATGAATTCTTGCATAAACCCAATAGCTCTATATTTTGTGAGCAAGAAATTCAA

AAATTGTTTTCAG TCCTGCCTCTGTTGCTGTTGTCACCAGTCCAAAAGCCTCATGACCTCGGTCCCCATGAATGGAACGAGTATCCAGTGGAAGAACCA

AGAGCAGAACAACCACAACACGGAACGGAGCAGCCACAAGGACAGCATGAACTAACCCTCCGCAGAAACACCGAGACGTGTGCCTTCAAGTCCTAGGATG

GAAACAACCATTACGCCACAGATGCGCTCCCAAAACCTCCCAAGTCTCTCCCATGCTCCTTTTCTAAGTCCATCCTAGGAAAAGCTCTCCTGCCCTCCCA

ACAGCACGTGGTGGACCGGTCCCAGCTATAGCCAATGGGTCTTTCCTGAGTACTGTATATGATTTGCATACCGCGCATGTCATTTCCAACACTTGAAAAT

TAGAGCTGGGAGAAAGGAGATGATGGTTCAAAGAAGCCACCTAGCTGCCGCCTTTGCATGAACACAGAGTTTGCAAGTTCATGACCAGCTTCCGTGCAGT

TCTATGGACCAGCTGGTGGGAACTGTCCATCCTAAGATTCTAGAGCAGTGGGTCTCAACCTTCCCAATGCTGCAGCCCCTTAATACAGTTCTTCATTTTC

CAGTGACCCCCCCCAACCACAATATTATTTTTTGTTGCTACTTCAATTATTTTGAATTGTTATAATTGTCTGATATTTCTGATAGTCTTAGCCTGCCCCT

GTTAAAGGGTCATTAGCAACCCACAAGTTGAGAACCACTGCCCTAGAAATTCTGTTGCGTTTCATGGCCCATGACTACAATCCTAAAATTGGAGAGGTGA

GGGAAGATGGTCAGGTGTTCAAGGTTAGCCTCATCAACATAGTTCGGAAAAGCCAGGGCTACCTGTTCTCACAAGACACAAACAGACAAAAAGTGTTTCA

AAGTTATGGCAGATTCATTATTATTAATTATTATTATCTTATAGCCAAACACATTGTGAGGTTAAAGTACTCTTTTGGAAATGTCACCGAGTGTTGGTAC

TTTATAACTGCATGGTACCCTAGAAATGATCGTTTCATCTTCTTTCAATGTACTCTGAAGAAAAGAAAGAGGAGAGGAAGAGGAGGAGGGAAGGAAGACC

GTCTGATGAGGAGTTAGTTGTTTCTATGGTACTGTTTTGTTTGGAAACCATGATTTCCACAGCTGCTGCAGACACAGACACAGACCAGCAGCACGGCAGC

TTAGTAGCTGCTAGACAAAGAATCTTTAAGAACCTGTATTTTCTTTTTATGTTGTTATTTGGTTGGATTTTGCTTGTTTACTTGGATTTGTTTTTCAAGA

CAGAGTTTCTCTTTGTAGCCCTGGCTGTCCTGAAACTTGTTTTATAAATCAGGCTGGCCTTGAACTCGCAGAGATCCTCCTGCTTCTGCCTCCCAAAGTA

CTAATAATACTTGGGCGAGATAGCACTGTGCTTCCAACTCGGCATCTGGAGGCTGAGGCAGGGACGGTGAGTGGGAGACTGCCTGCACTAACTAGAGGAA

CTCGTCTCCAAATAATAATAATTAATCATAATACCATTAGGTCAAATGGTTTTCTATTTTTCATAAGCCTAGTCTTTTTTAATGTTTTTTTTTTAATGTA

AAACCTTGTCCTGCAGATTAAATGTGTCACTGAAGTATGCCTGAGACTTCCAGCCCCACATCTGAAGCATACCTAGGAAAAAACTGCTGGGTGGCCTTGG

AGGGCCTGGGCATTTTCTACAAGTTTCACAATAGTAGCACATATATAATGCATGTTTCCTTTGACTCTCTCAGTTTCTCCTACAGTGATGACTGGCTACC

AGGCTTTCCTGCTCATTCCTTTTTCCTGGCAGGAAACAATGTCAAAGTGGCCAAATGAGCTGATTGTGTTAAGTGAGATGTAGTTACACTTGCCATGAAC

CTTTAACTCTTTGCTCCTCTCTGATTGTGAGACAAACTTAAATTTCCATCCTGTCCCCAACTCCTCAGTGGTCACTATTTCAAAGGGCCCTGGTAACTCT

ACTGGGCATTTTCCCAGATGTTTACAGACTGTGAGAATGACAAATAACTTTTATTTTGTATGTATATAAATATATAAATAATTGTACATTTCTTTTAGCC

AA
Translation
 - UNI32129 - MSIFCLAAYFWLTMVGGVMADNPERYSANLSSHMEDFTPFPGTEINFLGTTHRPPNLALPSNGSMHGYCPQQTKITTAFKYINTVI

SCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK - UNI32129 - LLAGRWPFDHNDFGVFLCKLFPFLQKSSVGIT

VLNLCALSVDR - UNI14197 - - UNI32129 - RYRAVASWSRVQGIGIPLITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGELHRTCMLNAT

SKFME FYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCE

LLS SFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQ SCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNNHNTERSSHKDSMN

For any suggestions or comments, please send an email to unitrap@crg.es