Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031620 (1700007B14Rik)
Chromosomal location
Chr 8: 77972690 - 78508402 (+)
Description
RIKEN cDNA 1700007B14 gene Gene [Source:MGI Symbol;Acc:MGI:1919081]
UniGene
Mm.443238 
MGI
MGI:1919081 
Uniprot/SPTREMBL
Q149I8 Q149I9 Q9DAN0 
Human Ortholog
not available
Omim not available
UniTrap UNI38508
Vector Insertion
Chr 8: 78078824 - 78099771
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI385
Vector Insertion
Chr 8: 78508090 - 78508378
Public Clones GC1245 (tigem) CMHD-GT_199E10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121983
Sequence
CAGAAGGTGACCCTGAGCCTGAAG CTCTCCCAAGGGGAAAGAAGAAAGATCAACAATGGCAGAAGTCTGTGGCAGCATAGGCGCAGAAAGAGCTTGCTT

TGTGCTCAGGAGAGAACACTGCATCTCAGCCTCCTGGTTTTAG CCCTGACTCTTACCATCACCTCTTAG TGGTGTTCAACATTCAAAAAAGGATAACC

CCAGCTCTACCTGCCCATCATGGCACCTGCAGAAGCTATACCTGAAGGAGTAG GCCCTGTATTGGAAACCACCCAGCAAGATTTTTTGCAAGAAGCAAA

ATCTCTTATTGCCCAACATCACAAGAGATTAAATGAG AATAAGGCTCAAGGAACGTCTATAGATGTCTTTAAAAATAAACACCAAAAACCGAAAACTGT

CAAGTTCATACCTTTTGAGGTTAAGAAAAGTGAAATTCTTAATGTAGTTCAAGAACATCGGTTGGTACTCAAAAGCATCAGCTATCCCAGGGACACTTCC

AAGTGCACAGCTTTAATTGAGGCCTCACAGCAGATTTCCTTCAAGGAGCCACATGTGTCGAATATAAAAGAGAAGTGCCACCCTGTAGATCTTTTAAAAG

AAG AAAAAGTTAAACTGGGTAAAATAATGAATGATATTGAATCCGTGAGTAAGCAAATGGAGATGGAGAAGGAGATGCATCTCAGGAAGTCCAG AATG

TTGGAACCCTTCCATTCCCACATGAGCTTGCCTTTGCATAATCTGGCCTCTTCTCTGGGACTTCTGAAGGAACTTG CTGACAGGACGCTTTATGATTGG

AGGAGCGCTGCATTGATAAGATCTTCCTATTTGCCTCATGGATCTGCTCAAAGTTTATCAGAGTCCTCAGTGACATTTAAGAATTATTATAAG AGACCC

ATTAGGAAGAAAGATCTGCAACCTATAAAGAAAGAACTGAAGACAGAAAAAAG GTCAAAGACTATTGCAAAGTCTGATAAAATAGACAGCAAAGTTAAA

AGAATTGGACCACACATAGAAATTTTCCAACTATTCCAGCGAAGAAACAAGACCATATTTACTAAAAGAATTATTAAACTGGTCACCACTGTGCAAGCAT

TTATCAGGGGATGGCTTGAGCGCAAAAGACTTCAACGAATAAAGAGCAAG GTTTCGTATCATGGGCCAAATTTGAAAACAGTTATAAAAATGTATCAGT

GCTTAATCCACCGTGTTAGACACCGACTTGGTCTTTGGAGGACAAGACAGATTATATACCTTGGAGAGTTAGAAGAATGGATGGATAGAAAAAAGT TCT

ATGAAACCATGTTTGCCAAGAGAGAAGACTGGCAAGGCCTAGAAAGAAGTGATCTGCTGAAATACTTCAACGACTGTGGTCATTTCCCCACCCAGACCCA

GATCGATGAGTACTGGGACCTGCTCCACAGAT ATGGTCAAGGAAGATATTCTGAAGTAATCAAAAAGTCCAATGCTATTGAACTATTATTTACACTCTA

CCCTCCTCAAGGTGCCAGAGTGAACATTAGCACAAGACTAAAGTCCACATGGCTGAGACCCTTGGTGGATGGGGAAGAAGGCTATAAGTACTTAG - UN

I385 - TGAATGGACATCCAATACTCAAGAGAGCTAACATCCGGACTGTTGGCAAGTTGGTGGCTCGATCCATAAGAGAAAGAAAAATGAGACAATTTT

ATAAAACATGAGAACTGGAATAAATTTTTCAGCACAGTGCTCCATTAAATAGTTGAACTTATCTCCTCAGAAATGCATATTAGTAATGAACACAGAATGA

TTTGCTATTGACAGGATAAAGGGTGAAATCTTTGGATGTTGACAAGTTAGTTCATCATTGATAAGTAAGTTTGGATGAGCGGTCTTTATCTTCCTCATTA

AACATCTGCTAATCATGAC
Translation
   MAPAEAIPEGVG GPVLETTQQDFLQEAKSLIAQHHKRLNE NKAQGTSIDVFKNKHQKPKTVKFIPFEVKKSEILNVVQEHRLVLKSISYPRDTSK

CTALIEASQQISFKEPHVSNIKEKCHPVDLLKEE EKVKLGKIMNDIESVSKQMEMEKEMHLRKSR RMLEPFHSHMSLPLHNLASSLGLLKELA ADRT

LYDWRSAALIRSSYLPHGSAQSLSESSVTFKNYYK RPIRKKDLQPIKKELKTEKR RSKTIAKSDKIDSKVKRIGPHIEIFQLFQRRNKTIFTKRIIKL

VTTVQAFIRGWLERKRLQRIKSK VSYHGPNLKTVIKMYQCLIHRVRHRLGLWRTRQIIYLGELEEWMDRKKF FYETMFAKREDWQGLERSDLLKYFND

CGHFPTQTQIDEYWDLLHRY YGQGRYSEVIKKSNAIELLFTLYPPQGARVNISTRLKSTWLRPLVDGEEGYKYLV - UNI385 - VNGHPILKRANI

RTVGKLVARSIRERKMRQFYKT
Transcript ENSMUST00000034033
Sequence
GTCCTGCTGCCCCAAAGAGAAGTAGGCTAGTGAATTCACAGTGTTGTGAGGAGTGAGAGGAGAGGGCACTAATGGGGCCTGGTAGGGCAACTGTGATTGG

GAGAGTGCCCTGGGGGCGGAGCTAAGGAGACAACAAGGGTGGGGCTAGTGTGACTCCACAACTACTAAAGAGGCTTGAAGGTTCTCTAGCCACAGAAGGT

GACCCTGAGCCTGAAG TGGTGTTCAACATTCAAAAAAGGATAACCCCAGCTCTACCTGCCCATCATGGCACCTGCAGAAGCTATACCTGAAGGAGTAG 

GCCCTGTATTGGAAACCACCCAGCAAGATTTTTTGCAAGAAGCAAAATCTCTTATTGCCCAACATCACAAGAGATTAAATGAG AATAAGGCTCAAGGAA

CGTCTATAGATGTCTTTAAAAATAAACACCAAAAACCGAAAACTGTCAAGTTCATACCTTTTGAGGTTAAGAAAAGTGAAATTCTTAATGTAGTTCAAGA

ACATCGGTTGGTACTCAAAAGCATCAGCTATCCCAGGGACACTTCCAAGTGCACAGCTTTAATTGAGGCCTCACAGCAGATTTCCTTCAAGGAGCCACAT

GTGTCGAATATAAAAGAGAAGTGCCACCCTGTAGATCTTTTAAAAGAAG AAAAAGTTAAACTGGGTAAAATAATGAATGATATTGAATCCGTGAGTAAG

CAAATGGAGATGGAGAAGGAGATGCATCTCAGGAAGTCCAG AATGTTGGAACCCTTCCATTCCCACATGAGCTTGCCTTTGCATAATCTGGCCTCTTCT

CTGGGACTTCTGAAGGAACTTG CTGACAGGACGCTTTATGATTGGAGGAGCGCTGCATTGATAAGATCTTCCTATTTGCCTCATGGATCTGCTCAAAGT

TTATCAGAGTCCTCAGTGACATTTAAGAATTATTATAAG AGACCCATTAGGAAGAAAGATCTGCAACCTATAAAGAAAGAACTGAAGACAGAAAAAAG 

GTCAAAGACTATTGCAAAGTCTGATAAAATAGACAGCAAAGTTAAAAGAATTGGACCACACATAGAAATTTTCCAACTATTCCAGCGAAGAAACAAGACC

ATATTTACTAAAAGAATTATTAAACTGGTCACCACTGTGCAAGCATTTATCAGGGGATGGCTTGAGCGCAAAAGACTTCAACGAATAAAGAGCAAG GTT

TCGTATCATGGGCCAAATTTGAAAACAGTTATAAAAATGTATCAGTGCTTAATCCACCGTGTTAGACACCGACTTGGTCTTTGGAGGACAAGACAGATTA

TATACCTTGGAGAGTTAGAAGAATGGATGGATAGAAAAAAGT TCTATGAAACCATGTTTGCCAAGAGAGAAGACTGGCAAGGCCTAGAAAGAAGTGATC

TGCTGAAATACTTCAACGACTGTGGTCATTTCCCCACCCAGACCCAGATCGATGAGTACTGGGACCTGCTCCACAGAT ATGGTCAAGGAAGATATTCTG

AAGTAATCAAAAAGTCCAATGCTATTGAACTATTATTTACACTCTACCCTCCTCAAGGTGCCAGAGTGAACATTAGCACAAGACTAAAGTCCACATGGCT

GAGACCCTTGGTGGATGGGGAAGAAGGCTATAAGTACTTAG - UNI385 - TGAATGGACATCCAATACTCAAGAGAGCTAACATCCGGACTGTTGGC

AAGTTGGTGGCTCGATCCATAAGAGAAAGAAAAATGAGACAATTTTATAAAACATGAGAACTGGAATAAATTTTTCAGCACAGTGCTCCATTAAATAGTT

GAACTTATCTCCTCAGAAATGCATATTAGTAATGAACACAGAATGATTTGCTATTGACAGGATAAAGGGTGAAATCTTTGGATGTTGACAAGTTAGTTCA

TCATTGATAAGTAAGTTTGGATGAGCGGTCTTTATCTTCC
Translation
 MAPAEAIPEGVG GPVLETTQQDFLQEAKSLIAQHHKRLNE NKAQGTSIDVFKNKHQKPKTVKFIPFEVKKSEILNVVQEHRLVLKSISYPRDTSKCT

ALIEASQQISFKEPHVSNIKEKCHPVDLLKEE EKVKLGKIMNDIESVSKQMEMEKEMHLRKSR RMLEPFHSHMSLPLHNLASSLGLLKELA ADRTLY

DWRSAALIRSSYLPHGSAQSLSESSVTFKNYYK RPIRKKDLQPIKKELKTEKR RSKTIAKSDKIDSKVKRIGPHIEIFQLFQRRNKTIFTKRIIKLVT

TVQAFIRGWLERKRLQRIKSK VSYHGPNLKTVIKMYQCLIHRVRHRLGLWRTRQIIYLGELEEWMDRKKF FYETMFAKREDWQGLERSDLLKYFNDCG

HFPTQTQIDEYWDLLHRY YGQGRYSEVIKKSNAIELLFTLYPPQGARVNISTRLKSTWLRPLVDGEEGYKYLV - UNI385 - VNGHPILKRANIRT

VGKLVARSIRERKMRQFYKT

For any suggestions or comments, please send an email to unitrap@crg.es