Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031622 (Sin3b)
Chromosomal location
Chr 8: 75247203 - 75281304 (+)
Description
transcriptional regulator, SIN3B (yeast) Gene [Source:MGI Symbol;Acc:MGI:107158]
RefSeq_peptide
NP_001106719.1 NP_033214.2 
UniGene
Mm.2137 
MGI
MGI:107158 
Uniprot/SWISSPROT
Q62141 
Uniprot/SPTREMBL
Q3TN09 Q80WX0 A1L326 Q3TXW9 
Human Ortholog
ENSG00000127511 (SIN3B)
Omim not available
UniTrap UNI7294
Vector Insertion
Chr 8: 75255178 - 75257243
Public Clones RRT473 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1420
Vector Insertion
Chr 8: 75277537 - 75280371
Public Clones CH0195 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109950
Sequence
TCCAACATGGCGCATGCAGGCAGCGGAGGCTCCGCGGGCCGGGGATTCGGTGGCTCCCGCTGGGGTCGTTCGGGCTCCGGAGGGCACGAGAAGCTGCCGG

TGCAC GTGGAGGACGCTCTCACCTACCTCGACCAGGTGAAGATCCGCTTTGGCAGTGACCCTGCCACCTACAACGGCTTCCTGGAGATCATGAAGGAGT

TCAAAAGCCAGAG CATCGACACTCCTGGTGTGATCAGGCGTGTGTCCCAGCTCTTCCATGAGCACCCTGACCTCATCGTGGGGTTTAATGCTTTCCTTC

CGCTTGGATACCGTATAGACATTCCCAAGAACGGCAAGCTGAACATCCAGTCGCCGCTGAGCAGCCAG GACAACTCCCATAGCCATGGTGACTGTGGGG

AGGACTTCAAGCAGATGTCCTACAAGGAGGACAGAGGCCAGGTGCCCCTGGAGTCTGACTCTGTGGAGTTCAACAATGCTATCAGCTATGTGAACAAGAT

CAAGACCCGCTTTCTGGACCACCCTGAGATCTACAGGTCCTTCCTGGAGATCCTACACACCTACCAG - UNI7294 - AAGGAACAGCTGCACACTAA

GGGCCGTCCATTCCGTGGCATGTCTGAGGAGGAGGTTTTCACAGAGGTGGCCAATCTTTTCCGTGGTCAGGAGGACCTGCTGTCAGAGTTCGGACAGTTC

CTGCCTGAGGCAAAGCGGTCCCTG TTTACAGGCAATGGGTCGTGCGAGATGAACAGTGGGCAGAAGAATGAGGAGAAGAGTCTGGAACACAACAAGAAA

CGCTCTCGGCCTTCACTCCTGCGCCCTGTGTCTGCGCCAGCCAAG GTGGGGCTGCAGTTGAAATGTGCAGTTGTGTGGTTTGGTTACTGCACAGCTGAG

GAGTGAAGGTGGCTGGCAACAGTTCCTGTCCTGCTCATCACCCATGATGGTGGATTTCTAGACCTGTCACTCTGTTTTCTAGTTGACTTTCTACAGTAAT

AAAATGATTTGGCATTTC
Translation
MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVH VEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQS SIDTPGVIRRVSQLFHEHPDLIVGFNAFL

PLGYRIDIPKNGKLNIQSPLSSQ DNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQ - UNI7294

 - KEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSL FTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAK VGLQLKC

AVVWFGYCTAEE
Transcript ENSMUST00000004494
Sequence
TCCAACATGGCGCATGCAGGCAGCGGAGGCTCCGCGGGCCGGGGATTCGGTGGCTCCCGCTGGGGTCGTTCGGGCTCCGGAGGGCACGAGAAGCTGCCGG

TGCAC GTGGAGGACGCTCTCACCTACCTCGACCAGGTGAAGATCCGCTTTGGCAGTGACCCTGCCACCTACAACGGCTTCCTGGAGATCATGAAGGAGT

TCAAAAGCCAGAG CATCGACACTCCTGGTGTGATCAGGCGTGTGTCCCAGCTCTTCCATGAGCACCCTGACCTCATCGTGGGGTTTAATGCTTTCCTTC

CGCTTGGATACCGTATAGACATTCCCAAGAACGGCAAGCTGAACATCCAGTCGCCGCTGAGCAGCCAG GACAACTCCCATAGCCATGGTGACTGTGGGG

AGGACTTCAAGCAGATGTCCTACAAGGAGGACAGAGGCCAGGTGCCCCTGGAGTCTGACTCTGTGGAGTTCAACAATGCTATCAGCTATGTGAACAAGAT

CAAGACCCGCTTTCTGGACCACCCTGAGATCTACAGGTCCTTCCTGGAGATCCTACACACCTACCAG - UNI7294 - AAGGAACAGCTGCACACTAA

GGGCCGTCCATTCCGTGGCATGTCTGAGGAGGAGGTTTTCACAGAGGTGGCCAATCTTTTCCGTGGTCAGGAGGACCTGCTGTCAGAGTTCGGACAGTTC

CTGCCTGAGGCAAAGCGGTCCCTG TTTACAGGCAATGGGTCGTGCGAGATGAACAGTGGGCAGAAGAATGAGGAGAAGAGTCTGGAACACAACAAGAAA

CGCTCTCGGCCTTCACTCCTGCGCCCTGTGTCTGCGCCAGCCAAG AAGAAGATGAAGCTCCGAGGCACCAAAGACCTGTCCATTGCTGCCGTGGGGAAA

TACGGCACACTGCAGGAATTCTCCTTCTTTGACAAG GTGCGCAGGGTGCTGAAGAGCCAGGAGGTATATGAGAACTTTCTGCGCTGCATTGCGCTCTTC

AATCAGGAGCTGGTGTCCGGGTCTGAGTTGCTGCAGCTTGTCAGTCCATTCCTGGG GAAATTTCCAGAACTCTTTGCACAGTTCAAGTCCTTCCTAGGA

GTGAAAGAGCTGTCCTTTGCACCACCTATGAGTGACCGGTCTGGAGATGGGATAAGCAGAGAAATTGACTATGCGTCTTGTAAGCGAATAGGATCCAGCT

ATCGGGCACTTCCCAAGACCTACCAGCAGCCCAAGTGCAGCGGAAGGACTGCCATTTGCAAGGAG GTCCTGAATGATACATGGGTCTCCTTTCCATCCT

GGTCTGAAGACTCCACCTTTGTTAGCTCCAAGAAGACGCCCTACGAGGAGCAACTGCATCGCTGTGAGGATGAGAGATTTGAA TTGGATGTTGTCCTGG

AGACCAACCTGGCCACCATCCGAGTGCTGGAGAGTGTGCAGAAGAAGTTGTCACGGATGGCTCCTGAGGACCAGGAGAAGCTCCGCCTGGATGACTGCCT

GGGTGGCACATCAGAGGTGATTCAACGCCGTGCCATACACCGCATCTATGGAGACAAGGCCCCAGAGGTCATTGAGAGCCTGAAAAGGAACCCTGCCACC

GCTGTGCCTGTCGTTCTGAAAAG GCTGAAGGCCAAGGAGGAGGAGTGGCGGGAGGCCCAGCAGGGCTTCAACAAGATCTGGCGTGAGCAGTACGAGAAA

GCATACCTCAAGTCCCTGGACCACCAGGCTGTGAACTTCAAGCAGAATGACACCAAGGCACTGCGCTCTAAGAGCCTGCTCAATGAGATCGAAAGTGTCT

ATGATGAG CACCAGGAGCAGCACTCAGAGGGCCGCAGTGCGCCTTCCAGCGAGCCGCACCTTATCTTCGTGTATGAGGACCGACAGATCCTAGAGGACG

CAGCAGCACTCATCAGCTACTATGTTAAGCGGCAGCCAGCCATTCAGAAAGAGGACCAGGGCACTATCCGCCAGCTGCTTCACCGTTTCCTGCCCAGCCT

GTTCTTCTCGCAGCAGTGCCCCGGCACCTCCGATGACTCTGCTGATGAGCGCGACCGGGACCGGGACAGCGCTGAGCCTGAGCGCCGCCGGCCCACAGAT

GAGAAGCCCCCTGCAGATGCATCTCCAGAACCGCCCAAGGTCCTGGACGATGTGTACAGTCTGTTTTTTGCCAACAACAACTGGTACTTCTTCCTGCGGC

TGCACCAGACGCTGTGCGCCCGCCTGCTCAAGATCTACCGGCAGGCGCAGAAGCAGCTGCTGGAACATCGACGAGAGCAGGAGAGGGAGCAGCTGCTGTG

CGAGGGCCGCCGTGAGAAGGCTGCAGACCCTGCCATGGAGCTGCGACTCAAGCAGCCTA GTGAAGTGGAGCTGGAGGAGTACTACCCGGCCTTCCTGGA

CATGGTGCGGAGCCTGCTAGAGGGGAGCATCGACCCCACACAGTATGAGGACACTCTCCGTGAGATGTTCACCATCCATGCCTACATTGGCTTCACTATG

GACAAGCTAGTGCAGAACATTGCCCGCCAG CTACACCATCTGGTGAGTGACGACGTATGTCTGAAGGTGGTAGAGCTGTACCTGAATGAGCAGCAGCGA

GGGGCAGCGGGGGGAAACCTGTCCTCCAGATGTGTTCGTGCAGCACGGGAGACTAGCTATCAGTGGAAGGCGGAGCGCTGCATGGCAGATGAGAACTGCT

TCAAG GTAATGTTCCTGCAGCGCAGAGGTCAGGTGATCATGACCATAGAGCTCCTGGACACAGAAGAGGCACAGACTGAGGACCCTGTGGAGGTACAG 

- UNI1420 - CACCTGGCTCGCTATGTGGAGCAGTATGTGGGGTCTGAGGGTGCATCCAGCTCATCTACTGAAGGCTTCCTGCTGAAGCCGGTGTTCC

TGCAGAG GAACCTGAAGAAGTTCCGGCGTTGGCAGTGTGAGCAGGTACGTGCCATGCGCGGTGAGGCTAAGAGCTCCTGGAAGCGGCTCATGGGCGTGG

AGAGCGCTTGTGATGTGGACTGCCGGTTCCGCTTGGGCACACACAAGATGGTGTTCATCGTCAATTCCGAGGACTACATGTACCGCCGTGGGACACTATG

CCGTGCCAAGCAG GTGCAGCCCCTGGTGTTGTTGCGCCACCACCGGCACTTCGAGGAGTGGCATGGTCGCTGGCTGGAGGACAATGTAACTGTGGCGGC

GGCAGGGCTGGTGCAGGACTGGCTGATGGGTGAGGAAGAGGAGGACATGGTACCCTGCAAGACGCTTTGCGAGACTGCGCATGTTCACGGGCTGCCGGTG

ACTCGCTACCGAGTGCAGTACAGCCGCCGCCCTGCTTCACCCTGA
Translation
MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVH VEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQS SIDTPGVIRRVSQLFHEHPDLIVGFNAFL

PLGYRIDIPKNGKLNIQSPLSSQ DNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQ - UNI7294

 - KEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSL FTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAK KKMKLRG

TKDLSIAAVGKYGTLQEFSFFDK VRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLG GKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISR

EIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKE VLNDTWVSFPSWSEDSTFVSSKKTPYEEQLHRCEDERFE LDVVLETNLATIRVLESVQKKLSR

MAPEDQEKLRLDDCLGGTSEVIQRRAIHRIYGDKAPEVIESLKRNPATAVPVVLKR RLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQAVNFKQND

TKALRSKSLLNEIESVYDE HQEQHSEGRSAPSSEPHLIFVYEDRQILEDAAALISYYVKRQPAIQKEDQGTIRQLLHRFLPSLFFSQQCPGTSDDSADE

RDRDRDSAEPERRRPTDEKPPADASPEPPKVLDDVYSLFFANNNWYFFLRLHQTLCARLLKIYRQAQKQLLEHRREQEREQLLCEGRREKAADPAMELRL

KQPS SEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYIGFTMDKLVQNIARQ LHHLVSDDVCLKVVELYLNEQQRGAAGGNLSSRCVRA

ARETSYQWKAERCMADENCFK VMFLQRRGQVIMTIELLDTEEAQTEDPVEVQ - UNI1420 - HLARYVEQYVGSEGASSSSTEGFLLKPVFLQR R

NLKKFRRWQCEQVRAMRGEAKSSWKRLMGVESACDVDCRFRLGTHKMVFIVNSEDYMYRRGTLCRAKQ VQPLVLLRHHRHFEEWHGRWLEDNVTVAAAG

LVQDWLMGEEEEDMVPCKTLCETAHVHGLPVTRYRVQYSRRPASP

For any suggestions or comments, please send an email to unitrap@crg.es