Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031665 (Sall1)
Chromosomal location
Chr 8: 91551147 - 91568061 (-)
Description
sal-like 1 (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:1889585]
RefSeq_dna
NM_021390 
RefSeq_peptide
NP_067365.2 
UniGene
Mm.214361 
MGI
MGI:1889585 
Uniprot/SWISSPROT
Q9ER74 
Uniprot/SPTREMBL
Q6P5E3 Q9EPW7 
Human Ortholog
ENSG00000103449 (SALL1)
Omim 107480 - TOWNES-BROCKS SYNDROME  113650 - BRANCHIOOTORENAL SYNDROME 1  
UniTrap UNI33898
Vector Insertion
Chr 8: 91566250 - 91568062
Public Clones IST14396E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6239
Vector Insertion
Chr 8: 91557298 - 91566250
Public Clones (sanger) CSG464 (baygenomics) D124C03 (ggtc) E140G05 (ggtc) D152B09 (ggtc)
E067B05 (ggtc) D142D01 (ggtc) IST10122D12 (tigm) IST10122C11 (tigm)
IST10654H10 (tigm) IST14793B10 (tigm) IST14810B2 (tigm) IST12587C5 (tigm)
IST10122B11BBR1 (tigm) IST15052E12 (tigm) IST13010D6 (tigm) IST10122D11 (tigm)
IST11229G2 (tigm) IST10122A11BBR1 (tigm) IST12318F12 (tigm) IST12506C5 (tigm)
IST13321E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7886
Vector Insertion
Chr 8: 91552718 - 91553842
Public Clones RRM007 (baygenomics) IST12656G10 (tigm) IST13125D7 (tigm) IST12968G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034090
Sequence
CGGGAACCTCGGCGAGCGGAAACCCCGAGGCAGGAGGAGGTCTAAACTAAGCCGAGGACCAAGCCTCAGGTTCGCAGGCGCCCAAACCCGGAAGAGGGAG

TACAGGGCCCGGATCCCTGGGTCCCGTGAGCGG - UNI33898 - CTGATGTTTGAGCCAGCATGTCGCGGAGGAAGCAAGCGAAGCCTCAACATTTC

CAATCCGACCCCGAAGTGGCCTCGCTCCCCCGGCGAGATG - UNI6239 - - UNI33898 - GGGACACAGAGAAGGGTCAACCAAGTCGCCCCAC

TAAGAGCAAGGATGCCCATGTCTGTGGCCGGTGCTGCGCTGAATTCTTTGAATTATCAGACCTTCTGCTCCATAAAAAGAGCTGCACTAAGAATCAATTA

GTTTTGATTGTCAATGAAAGTCCAGCCTCCCCAGCAAAAGCCTTCCCTCCTGGCCCGTCTCTCAATGATCCCGACGACCAAATGAAAGACGCGGCGAATA

AAGCAGACCAAGAAGACTGCAGCGACCTTTCAGAACCCAAGGGGCTTGACAGGGAAGAGTCCATGGAGGTGGAGGTCCCAGTTGCCACCACCACCACCAC

CACCACTGGCGGCAGCGGCGGGAGTGGTGGCAGCACTCTGAGCGGTGTCACCAACATCACCACCCCGAGCTGCCACAGCGGCTCTTCCACGGGTACCTCA

GCGATCACAACCTCTCTACCTCAACTGGGGGACCTGACGACACTGGGCAACTTCTCGGTGATCAACAGCAACGTCATCATTGAGAATCTCCAGAGCACCA

AGGTAGCGGTGGCCCAGTTCTCCCAGGAGGCGAGGTGTGGGGGGGCCTCCGGAGGCAAGCTGCTCATCTCAACCCTCATGGAACAACTCCTGGCTCTGCA

GCAGCAGCAGATTCACCAGCTGCAGCTCATAGAGCAAATACGTCACCAAATACTGCTGCTGGCCTCTCAGAGCGCAGACCTGCCGGCAGCACCCTCTATC

CCGTCTCAAGGTACTTTACGAACATCTGCCAACCCCTTGACCACACTGAGCTCCCATCTGTCTCAACAGCTGGCGGTGGCAGCTGGATTAGCACAGAGCC

TTGCTAGCCAATCTGCCAACATCAGCGGTGTGAAGCAGCTCCCCCACGTCCAGCTACCTCAGAGCAGCTCCGGCACCTCCATCGTCCCGCCCAGTGGTGG

CACTTCTCCCAACATGAGCATAGTGACGGCTGCAGTGCCCACCCCGTCCTCAGAAAAAGTGGCTTCCAATGCTGGTGCCTCCCATGTCAGCTCCCCGGCC

GTCTCAGCATCGTCCTCACCAGCATTCGCAATAAGCAGTCTGTTGAGTCCTGCATCTAACCCACTTCTACCTCAGCCGACCCCAGCTAACGCTGTTTTCC

CTACCCCTTTGCCTAACATTGCAACAACCGCAGAAGATTTGAACTCCCTGTCTGCCTTGGCCCAGCAAAGAAAAAGCAAGCCACCAAATGTCACTGCCTT

TGAAGCGAAAAGTACTTCAGACGAGGCGTTCTTTAAACACAAGTGCAGGTTCTGTGCGAAGGTCTTCGGGAGCGACAGTGCCTTGCAGATCCACTTGCGC

TCCCATACTGGAGAGAGGCCATTCAAGTGCAACATCTGTGGGAACAGGTTCTCTACTAAGGGCAATCTGAAAGTCCACTTCCAGCGCCACAAAGAGAAGT

ACCCCCACATCCAGATGAACCCCTACCCTGTACCGGAGCACTTGGACAATGTCCCCACGAGCACCGGCATCCCCTACGGCATGTCCATCCCTCCAGAGAA

GCCAGTTACCAGCTGGCTAGACACCAAGCCAGTCCTGCCCACTCTGACCACTTCCGTCGGCCTACCATTGCCTCCAACTCTCCCAAGCCTCACGCCCTTC

ATCAAGACGGAAGAGCCAGCCCCCATCCCTATTAGCCATTCTGCTGCCAGTCCCCAAGGCTCAGTCAAAAGTGACTCCGGGGCCCCTGATTTGGCCACAA

GAAACCCAAGTGGCGTCCCTGAGGAAGTGGAAGGGTCTGCTGTGCCACCCTTTGGTGGCAAGGGTGAAGAGAGTAACATGGCAAGCTCCGCCGTCCCGAC

AGCGGGCAACAGTACTCTGAACTCCCCAGTGGCTGACGGTGGTCCAGGAGGGACCACCTTCACCAACCCTCTGTTGCCCCTCATGTCTGAGCAGTTCAAG

GCCAAGTTTCCTTTTGGGGGACTCTTAGATTCGGCCCAGGCCTCAGAGACATCCAAGCTGCAGCAACTGGTAGAAAACATTGACAAGAAGGCCACGGATC

CCAATGAGTGTATCATCTGCCACCGGGTTCTCAGCTGTCAGAGCGCCTTGAAAATGCACTACCGGACACACACTGGGGAGAGGCCCTTCAAGTGTAAGAT

CTGCGGCCGGGCTTTCACCACGAAAGGGAACCTCAAGACCCACTACAGCGTCCATCGGGCTATGCCTCCACTCAGAGTCCAGCATTCCTGCCCCATCTGT

CAGAAGAAGTTCACAAACGCAGTGGTCCTCCAGCAGCATATTCGTATGCACATGGGAGGCCAGATCCCCAACACCCCAGTCCCTGACAACTACCCTGAGT

CCATGGAGTCTGACACAGGCTCCTTTGATGAGAAAAATTTCGACGACTTAGACAACTTCTCAGATGAGAATATGGAAGAGTGTCCTGAGGGCAGCATCCC

AGACACACCCAAGTCAGCGGACGCTTCCCAAGATAGCCTGTCATCTTCGCCTCTGCCCCTCGAGATGTCGAGCATCGCTGCTCTGGAAAATCAGATGAAG

ATGATCAATGCTGGCCTGGCGGAGCAGCTGCAGGCCAGCCTGAAGTCTGTGGAGAACGGATCCATGGAAGGGGATGTGCTGACCAACGACTCTTCCTCAG

TGGGTGGCGACATGGAGAGCCAGAGTGCAGGCAGCCCAGCCATCTCAGAGTCTACCTCTTCCATGCAGGCTCTGTCCCCGTCCAACAGCACCCAAGAATT

CCACAAGTCACCCGGCATGGAGGAAAAGCCACAGCGAGTGGGGCCAGGCGAGTTCGCCAATGGTCTATCTCCCACCCCAGTGAACGGAGGTGCTTTGGAC

TTGACTTCTAGTCATGCAGAGAAAATCATCAAAGAAGATTCTCTGGGAATCCTCTTTCCTTTCAGAGACCGGGGTAAATTTAAAAACACTGCTTGCGACA

TTTGTGGCAAGACCTTTGCTTGTCAGAGTGCCTTGGACATTCACTACAGAAGTCATACCAAAGAGAGACCGTTCATTTGCACAGTTTGCAATCGTGGCTT

TTCCACAAAGGGTAATTTGAAGCAGCACATGTTGACACATCAGATGCGAGATCTGCCATCGCAGCTCTTTGAGCCCAGTTCCAACCTCGGCCCCAATCAG

AACTCTGCAGTGATTCCCGCCAACTCGCTGTCATCTCTCATCAAAACAGAGGTCAACGGCTTTGTACACGTTTCTCCTCAGGACAGTAAGGACGCCCCCA

CTAGTCATGTCCCTCAGGGGCCTCTGTCGTCCTCTGCGACATCCCCAGTTCTGCTCCCAGCTCTGCCCCGGAGAACTCCCAAACAGCACTATTGTAACAC

GTGTGGTAAAACCTTCTCTTCTTCGAGTGCCCTGCAGATCCACGAGAGAACTCACACTGGAGAGAAGCCCTTTGCTTGCACTATCTGTGGAAGAGCATTC

ACAACAAAAGGCAATCTGAAG - UNI7886 - GTCCACATGGGCACCCATATGTGGAACAGCACCCCTGCACGCCGGGGCCGGCGGCTCTCAGTGGAT

GGCCCCATGACATTTCTAGGAGGCAATCCTGTCAAGTTCCCAGAAATGTTCCAGAAGGATCTAGCGGCGAGGTCAGGAAGTGGGGATCCGTCCAGCTTTT

GGAACCAGTATACAGCAGCACTGTCCAACGGGCTGGCCATGAAGGCCAACGAGATCTCTGTCATTCAGAACGGCGGCATCCCTCCAATTCCTGGAAGCCT

GGGCAGTGGGAGCAGCTCACCTATCAGTGGGCTGACTGGGAACGTGGAAAAACTGGGCAATTCGGAACCCAGTGCTCCTCTGGCTGGCCTGGAGAAAATG

GCGAGCAGCGAGAACGGAACCAACTTCCGTTTCACCCGCTTCGTGGAGGACAGCAAAGAGATCGTCACAAGCTAAAGCTGCCAGAGTGCTTCCTCTCAGA

ATGTCGCCCGAGGTTGCCTCCTGCCCCTCCCCCCGCCCTTTACCTTCTGGCCCCTGGGACTATGAACTACACTATGAAGACATTCTTTTGTATGTTGTTC

AACCTCTAGAGTTCTAAGAAAGCTTATTTATTAGTGCTATAACCTTGCTTTGCAAACAGAGTGCAGGCATTAACTTTGGTCTTCTGTATTTTGGACTAAA

TACTAATGGACTAGAGTGCTCCTAGCTTGCTGTAACATTTATGGCAATCGCAAGTTGCCCTGCTAGGCGGTCTTAATCCGGCATTAACTTATTTTCTATA

TCCAGTTTAATATGAATCTGGTGTTGATGCAATGCCTCCGTGATACGTTAGATCTCTAATAAAGTCTGTATATAAATGTACACTTTGATCCTGCTGGAAA

ATTTTATCAGCGAACACATTGTCTAATCTTTCCAAACAGATTTAAGGGAAGGACTTTAAGTACAGGCTGAACATTTGGAAGGCTTAGGGTTTGTTGTTGT

TGTTGTTTGTTTGTTTGTTTGTTTTGGTTTTGGTTTCATTTTGATTCTAAACTTCAACCTGCTTTTTTTTTGGTTTTGTTTTAGAGAGTTAACCATTTCC

GTTTTGAACTATTTGTATTGTGCTTTTTACTTGAGTCGTCTTCAATGTTAATACGTTTCTGTACAGTAATAAGCACGCAGAATTCTTTAGAGGAAAAAAA

AACCACAAGTGTTGTTTTGGTAGTTGAAACTGAGACGTAGCATTTTGGCCTTGTAGGGTATATTCACAGTAGAAAACGTGTGCTGGAATTTCACAATGCT

GCTAACGATAGCATCTTGAACGACCTTCAGTGGAGAAATGTAGATGCTCTTCTATATACAATAAGAAATATCACTTTCATTAAAATGTACATATGTTCCT

TACAAGAGCAAATGCCTCTTGATCAAGAGCAGGTATAGTGTTGGTTTATTTTGTATTAGGTATGGAAGGAAAAAAATGGACTGTTACATGCACTTTCTTG

GAAAGTTGAAGGGGGGGGTTCCAATTTCTTTAACATTTAATACTTACTAACAACAGAGATACTGTAATTTTACTCAAGTAATCAAATACATTTTTTTTGC

AACAG
Translation
 - UNI33898 - MSRRKQAKPQHFQSDPEVASLPRRDG - UNI6239 - - UNI33898 - GDTEKGQPSRPTKSKDAHVCGRCCAEFFELSDLL

LHKKSCTKNQLVLIVNESPASPAKAFPPGPSLNDPDDQMKDAANKADQEDCSDLSEPKGLDREESMEVEVPVATTTTTTTGGSGGSGGSTLSGVTNITTP

SCHSGSSTGTSAITTSLPQLGDLTTLGNFSVINSNVIIENLQSTKVAVAQFSQEARCGGASGGKLLISTLMEQLLALQQQQIHQLQLIEQIRHQILLLAS

QSADLPAAPSIPSQGTLRTSANPLTTLSSHLSQQLAVAAGLAQSLASQSANISGVKQLPHVQLPQSSSGTSIVPPSGGTSPNMSIVTAAVPTPSSEKVAS

NAGASHVSSPAVSASSSPAFAISSLLSPASNPLLPQPTPANAVFPTPLPNIATTAEDLNSLSALAQQRKSKPPNVTAFEAKSTSDEAFFKHKCRFCAKVF

GSDSALQIHLRSHTGERPFKCNICGNRFSTKGNLKVHFQRHKEKYPHIQMNPYPVPEHLDNVPTSTGIPYGMSIPPEKPVTSWLDTKPVLPTLTTSVGLP

LPPTLPSLTPFIKTEEPAPIPISHSAASPQGSVKSDSGAPDLATRNPSGVPEEVEGSAVPPFGGKGEESNMASSAVPTAGNSTLNSPVADGGPGGTTFTN

PLLPLMSEQFKAKFPFGGLLDSAQASETSKLQQLVENIDKKATDPNECIICHRVLSCQSALKMHYRTHTGERPFKCKICGRAFTTKGNLKTHYSVHRAMP

PLRVQHSCPICQKKFTNAVVLQQHIRMHMGGQIPNTPVPDNYPESMESDTGSFDEKNFDDLDNFSDENMEECPEGSIPDTPKSADASQDSLSSSPLPLEM

SSIAALENQMKMINAGLAEQLQASLKSVENGSMEGDVLTNDSSSVGGDMESQSAGSPAISESTSSMQALSPSNSTQEFHKSPGMEEKPQRVGPGEFANGL

SPTPVNGGALDLTSSHAEKIIKEDSLGILFPFRDRGKFKNTACDICGKTFACQSALDIHYRSHTKERPFICTVCNRGFSTKGNLKQHMLTHQMRDLPSQL

FEPSSNLGPNQNSAVIPANSLSSLIKTEVNGFVHVSPQDSKDAPTSHVPQGPLSSSATSPVLLPALPRRTPKQHYCNTCGKTFSSSSALQIHERTHTGEK

PFACTICGRAFTTKGNLK - UNI7886 - VHMGTHMWNSTPARRGRRLSVDGPMTFLGGNPVKFPEMFQKDLAARSGSGDPSSFWNQYTAALSNGLAM

KANEISVIQNGGIPPIPGSLGSGSSSPISGLTGNVEKLGNSEPSAPLAGLEKMASSENGTNFRFTRFVEDSKEIVTS

For any suggestions or comments, please send an email to unitrap@crg.es