Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031672 (Got2)
Chromosomal location
Chr 8: 98388036 - 98412301 (-)
Description
glutamate oxaloacetate transaminase 2, mitochondrial Gene [Source:MGI (curated);Acc:Got2-001]
RefSeq_dna
NM_010325 
RefSeq_peptide
NP_034455.1 
UniGene
Mm.230169 
MGI
MGI:95792 
Uniprot/SWISSPROT
P05202 
Human Ortholog
ENSG00000125166 (GOT2)
Omim not available
UniTrap UNI646
Vector Insertion
Chr 8: 98401770 - 98412116
Public Clones DD0442 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6912
Vector Insertion
Chr 8: 98398364 - 98399645
Public Clones RRX144 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25533
Vector Insertion
Chr 8: 98389152 - 98390720
Public Clones not available
Private Clones OST178597 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034097
Sequence
ACTGTCCTCACCTTTTAGGAGCCCGCGCCTCGGTTCCAGCGGACGCTTCCCCAGATCTCGGCTCTACCACCATCCACTGCCGTCTTACCGCCCACCATGG

CCCTCCTGCACTCCAGCCGCATCCTCTCCGGGATGGCTGCTGCCTTTCACCCAGGCCTAGCTGCTGCAGCCTCTGCCAGAGCCAG - UNI646 - CTC

CTGGTGGACCCATGTTGAAATGGGACCTCCAGATCCCATCCTGGGCGTTACCGAAGCCTTCAAGAGAGATACCAACAGCAAGAAGATGAACCTGGGAGTT

GGTGCCTACCGGGATGATAACGGAAAACCTTACGTGCTCCCCAGTGTCCGGAAG GCAGAGGCCCAGATTGCTGCAAAAAATTTGGACAAAGAATACCTG

CCCATTGGGGGACTGGCTGAATTCTGTAAGGCTTCTGCAGAACTGGCCCTGGGCGAGAACAATGAAGTGTTGAAAAGCGGCCGG - UNI6912 - TTC

GTCACTGTGCAGACCATTTCCGGGACTGGAGCCTTAAGGGTCGGGGCCAGTTTTCTG CAAAGGTTTTTTAAGTTCAGCCGAGATGTCTTTCTGCCCAAA

CCATCCTGGGGAAATCACACGCCCATCTTCAGGGATGCCGGCATGCAGCTCCAAGGTTATCGCTACTATGACCCCAAGACTTGCGGTTTTGACTTCTCTG

GAGCCCTAGAAGACATATCA AAAATCCCAGAGCAGAGTGTCCTCCTCCTGCATGCCTGCGCTCACAACCCCACCGGCGTGGACCCGCGTCCCGAGCAGT

GGAAGGAGATAGCGTCCGTGGTGAAG AAAAAGAATCTCTTCGCATTCTTTGACATGGCCTACCAAGGCTTTGCCAGCGGTGATGGTGATAAGGATGCCT

GGGCCGTGCGGCACTTCATCGAGCAGGGCATCAATGTCTGCCTCTGCCAATCGTATGCCAAGAACATGGGCCTGTACG GTGAGCGTGTGGGAGCCTTCA

CGGTGGTCTGCAAAGATGCAGAAGAAGCCAAAAGGGTGGAGTCACAGCTGAAGATCTTGATCCGTCCCCTGTATTCCAACCCACCTCTCAATGGGGCCCG

GATCGCAGCAACCATCCTGACTTCTCCAGACTTGCGGAAGCAATG GTTGCAAGAGGTGAAAGGCATGGCTGACCGCATCATCAGCATGAGGACCCAGCT

GGTCTCCAACCTGAAGAAAGAGGGCTCTTCCCACAACTGGCAGCACATCACCGACCAGATCGGCATGTTCTGTTTCACCGGCCTAAAGCCAGAGCAG - 

UNI25533 - GTAGAGCGGCTGACCAAGGAGTTCTCGGTCTACATGACAAAGGATGGCCGAATCTCCGTGGCAGGGGTCACCTCTGGCAATGTGGGCTA

CCTTGCCCATGCCATTCACCAGGTCACCAAGTAATTCCCAGGTGCAAAGGAACAGAGACCACTTTCCCGACAGCCTTTGCGCTCGTGAGCGTCACGTGCA

GGGTGAGGGAGGGTGGGTGGTGGTGAATAGATCCGGTTTCCAACCACGGTGCATAACTCAGCGACTGAACTCGCTCCTCGGAAGAGAGGTAGGGCAGAGG

CTTCCTCGGCTGGTATCTGGAACTTCGTCGGCTCTAAACCAAACTCCCTCATCCTTTTGTCTCCAGCTTTTCTGAAAGTTTACACACGCAAGAAAAATCA

CAGCACCAAACACCTGTCAGCCATGGCACTGGAATAGGTCAGACGCTTTACCTAAAGCCTCAGGTGGTATCAGGGGCTCCCCCGTGGACCCCAGTAGAGC

CTCCCCTAATAGAGGCTATAAGAGAAAAATAACTAGTTCTGTCATTAACAGTTGTCCTCAAGTTCGTCCTCTTGGTGTGGAGCAAACTGTGTCAGCAGAC

CACATTACAGAAATTATGCTTTACAAAAACCAACAGGTCTGTTGCCACTTCAACAGGGACAGTAGAAGATGTAGTGTCGTGTCCGCCTGCCCCTTGTCAT

TGCTGTTCTAGAGCCTAGAGTCTCATCCCGTTCTACTGCAAACATCCGCCTCAGCCTATGGGGGGAGTTACATAAGAATGGAGAGCATAGGTTTTCTGCT

CCTGCATAGCCTCCTCTCTCATCAAAGAGCCGTGGAGAGAGAGAGACCCTGCCCTTGATTTCAGAGTCCTCTTCAGTCATTGATTGATTGGCTCCTACTG

GGATGGGGCCTCTGCCCAGCTGGACCTCTTCATCCATCCTGGCTGCACAGCCTGTCTCTTCACATGAGTCAGACGTGCAGGGTAGGATCAGAAGGAGATA

CTCTGGGGTTTGTGTGCTGCCAGCCCGGCTCAGACTCCGCCCTTGGGAAAGATAACCACCATCTGCTCTAATCATGTAGACGTACTGCCGCCTGGTTTCT

CTGTTACAATAAAATTACTATAGACCC
Translation
MALLHSSRILSGMAAAFHPGLAAAASARAS - UNI646 - SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRK AEAQ

IAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGR - UNI6912 - FVTVQTISGTGALRVGASFL QRFFKFSRDVFLPKPSWGNHTPIFRDA

GMQLQGYRYYDPKTCGFDFSGALEDIS KIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVK KKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGIN

VCLCQSYAKNMGLYG GERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQW WLQEVKGMADRIISMRTQLVSNLKKEG

SSHNWQHITDQIGMFCFTGLKPEQ - UNI25533 - VERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK

For any suggestions or comments, please send an email to unitrap@crg.es