Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031673 (Cdh11)
Chromosomal location
Chr 8: 105156895 - 105309011 (-)
Description
cadherin 11 Gene [Source:MGI Symbol;Acc:MGI:99217]
RefSeq_dna
NM_009866 
RefSeq_peptide
NP_033996.4 
UniGene
Mm.1571 Mm.457140 
MGI
MGI:99217 
Uniprot/SWISSPROT
P55288 
Uniprot/SPTREMBL
Q8C7Q6 
Human Ortholog
ENSG00000140937 (CDH11)
Omim not available
UniTrap UNI14092
Vector Insertion
Chr 8: 105203912 - 105244312
Public Clones CMHD-GT_100F1-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000075190
Sequence
CTCATTCCTGCCACTAGCGCGCTCCGCGGCTCATTCCGCGGCCGCCGCCAGCTGAGGGGAGCGTCGCGGGCCGAGGAGCAGATGCCGCGGGGGCCGCTCG

CAGCCGCCGCCGACTTGTGAATGGGACTCGGACCGGGGCCCGGGCTGACACCGCTGCGCTCGCCCCGTGCCAGGGACAGCCGGCCAGGAGGTCGTGTCCA

CCCGCAACGGCCCCAG AAATTACTGTGCTTTGTGGCCCTTTGAAGACATTCAGTTCTGTTATTTATTGAATGACCAATCAGATGGGTGGAGCATGTTAT

AGGAATTGGCAGCAGGTATCCAATGGGTGAAGAAG - UNI14092 - AAGCTGACTGCGGAGGTGACCAACCCTGGCGTGATGTCCTCAGTGAGTGAA

GATATTCCATTCCAGAGGAGGTCTACTTGACACATCTGGGAGGCCGCCATCCGAAAGAAAGCCACTCTGTTGGTGTAGGGAGTGACAGCTGCATTCTCCT

GTGCCTACTGCATAACCAAAAATGAAGGAGAACTACTGTTTACAAGCTGCCCTGGTGTGCCTGAGCATGCTATACCACAGCCAGGCGTTTGCTCTGGAGC

GACGAAGCCACCTGCATCCCTCTTTCCATGGACACCATGAGAAGGGCAAGGAGGGGCAGGTGCTGCAACGCTCCAAGAGAGGCTGGGTCTGGAACCAATT

CTTTGTGATAGAAGAGTACACCGGGCCTGACCCTGTGCTGGTGGGCAGG CTTCATTCTGACATTGACTCCGGTGATGGGAACATTAAATACATTCTCTC

AGGTGAAGGAGCGGGAACCATTTTTGTGATTGATGACAAATCAGGGAACATTCATGCCACCAAGACATTGGACCGAGAGGAGAGAGCCCAGTACACACTG

ATGGCTCAGGCGGTGGACAGGGACACCAACAGACCACTGGAGCCACCTTCAGAATTCATTGTTAAGGTCCAGGACATTAATGACAACCCTCCAGAGTTTC

TGCATGAAATCTATCATGCCAATGTGCCTGAGAGGTCCAATGTGG GAACATCAGTTATCCAAGTGACAGCCTCTGATGCAGATGATCCCACCTATGGAA

ATAGTGCCAAGTTAGTGTATAGCATCCTTGAAGGACAACCCTATTTCTCGGTGGAGGCCCAAACAG GTATCATCAGGACAGCCCTTCCCAATATGGACA

GAGAAGCCAAGGAGGAGTACCACGTGGTGATCCAGGCCAAGGACATGGGTGGACACATGGGTGGACTCTCAGGGACAACCAAAGTGACGATCACTCTGAC

TGATGTCAACGACAACCCACCAAAGTTTCCACAGA GCGTGTACCAGATGTCTGTATCAGAAGCAGCTGTCCCGGGGGAGGAAGTAGGAAGGGTGAAGGC

TAAAGACCCAGACATTGGAGAAAATGGCTTAGTCACATACAATATCGTTGATGGAGACGGCATAGAACTGTTTGAAATTACAACAGACTATGAAACACAG

GATGGTGTGGTGAAGCTGAAAAAG CCTGTAGATTTTGAAACCAAAAGAGCTTATAGCTTGAAGATAGAGGCCGCCAATGTTCACATTGATCCGAAGTTC

ATCAGCAATGGACCTTTCAAGGACACTGTGACCGTCAAGATTTCAGTAGAAGATGCCGATGAGCCTCCCATGTTCTTGGCCCCAAGTTATATCCATGAAG

TTCAAGAAAATGCAGCTGCTGGCACTGTGGTTGGGAGAGTACATGCCAAAGACCCAGATGCTGCCAACAGCCCAATAAG GTATTCAATTGATCGTCATA

CTGACCTCGACAGGTTTTTCACGATTAATCCAGAAGATGGTTTTATTAAAACTACGAAACCTCTAGATAGGGAAGAAACTGCCTGGCTCAACATCTCTGT

CTTCGCAGCAGAAATTC ACAACAGACATCAGGAAACCAAAGTCCCAGTGGCCATCAGGGTCCTGGATGTCAATGACAATGCTCCTAAGTTTGCTGCCCC

TTATGAAGGTTTTATCTGTGAGAGCGATCACCCCAAGGCACTCTCCAACCAG CCAATAGTTACAGTTAGTGCAGATGACCAGGACGACACAGCCAATGG

ACCAAGATTTATCTTCAGCCTACCCCCTGAAATCATGCACAACCCAAACTTCACAGTAAGAGACAACAGAG ATAACACTGCAGGAGTATATGCCCGACG

TGGAGGGTTCAGTCGGCAGAAGCAGGACTTCTACCTCCTGCCCATTGTGATCAGTGATGGTGGCATTCCACCTATGAGTAGCACCAATACCCTCACTATC

AAAGTCTGTGGCTGTGATGTGAATGGGGCACTGTTGTCCTGTAACGCTGAAGCCTACATCCTGAATGCCGGTCTGAGCACTGGGGCACTGATCGCCATCC

TTGCCTGCATCGTCATTCTTCTGG TCATCGTTGTGCTGTTTGTTACCCTGAGGAGGCAAAAGAAAGAACCACTCATTGTATTTGAAGAGGAGGATGTCC

GTGAGAACATCATAACCTATGATGATGAAGGGGGTGGTGAGGAAGACACTGAAGCCTTCGACATAGCCACCCTGCAGAATCCTGACGGCATCAATGGATT

TATCCCTCGCAAAGATATCAAACCTGAGTATCAGTATATGCCTAGACCTGGGCTGCGACCAGCACCCAACAGTGTGGATGTGGACGACTTCATCAACACA

AGAATACAGGAGGCAGATAATGATCCCACAGCCCCTCCCTATGACTCCATCCAAATCTATGGTTATGAGGGCCGGGGTTCCGTGGCTGGGTCCCTGAGCT

CCTTGGAGTCTGCCACGACAGACTCAGACCTGGACTACGACTATCTACAGAACTGGGGACCTCGTTTTAAGAAACTGGCAGACTTGTATGGCTCCAAAGA

CACTTTTGATGATGACTCTTAACAATAATGTTACAAATTTGGCCTTAAGAACTGTGTCTGGCATTCTCAAGAATCTAGAAGATGTGTAAACAGGTATTTT

TTTAAATCAAGGAAAGGCTCATTTAAAACAAGCAGAGTTTTACAGAGAGGAAACATTTAATAAAACTGCAAGGACATCAAAGTGGAAAATACTGTGAAGT

ACCTTTTCCCACTTAAAAAGCAAATATTGAAGTTGTTTATCAACTTCAGTAGAAAAAAAAAAACCACTTGGCACACAAAATATTTAAATGAAGGAGAAGT

CCACGGTGAACTTACAATGAAGGGAAATCGTCTATGTGTTAAGAACATCTAAGTCTCTCTTATTTTATTTTTTAATTTGTCAAAGAAGCTTCCACAAAAT

TAGAAAGGACAACAGTTCTGAGCTGTAATTTCGCCTTAAACTATGGACACTCTATCTGTAGTGCGTTTTTAAACTTGAAATATATAATATCCAGCCAGCT

TAAACCCATACAATGTATGTACAATACAATGTACAATTATGTCTCTTGAGCATCAATCTTGTTACTGCTGATTCTTGTAAATCTTTTTGCTTCTACTTTC

ATCCTAAACTAATACGTGCCAGATATAACTGTCTTGTTTCAGTGAGGAGCACCCTATTTCTATGTCATTTTTAATGTATCTATTTGTACAATTTTAAAGT

TCTTATTTTAGTATACATACAAATATCAGTATTCTGACATGTACGAAAATGTTACAGCATCACACTTATATTTTATGAACATTGTACTGTTGCTTTAATA

TGAGCTTCAATATAAGAAGCAACCTTTGAAATAAAAAAAAGATTCTTTTTTAATTCTGGGTTTGATTCTTAACATTGAAAAAAAATAAGGGTTTCTAATG

ATCCATTTATATTCCTAATTTAATTGTGATCTTTAATAACCCTATTTATGATCTGTTGTAGTCTGCTGCTCTCATTGTTTATTTAAATCAAATATGTTTG

AGTTTTTTTAAAGATAAGATTCTGTAACTTCATGTAAATGATTTTTTGTATGTTCTGGCTTTTCCTGGAGTATATCTTCTAAAGAAGGACATTAGAGATC

TAGACTAGCCTATGATTAGCCTATGATTTTACAATATGTTATATATTATGCATTTAACCTGTGAACTCATAGTTATGAGAGACAAATTCATGAGGACTGC

CAGACCTCTCGATGTTCTAGATATAGACTTGATGCCCTGCCTTGAGCATTGTGGAGTTGAAGGGGTGCAGAGTCAAAGCCAACTCTGGTTTTCCTTATGT

AATTTTTATTAGGATAAAGACTGACTGACAGTTGAAAGTTC
Translation
  - UNI14092 - MKENYCLQAALVCLSMLYHSQAFALERRSHLHPSFHGHHEKGKEGQVLQRSKRGWVWNQFFVIEEYTGPDPVLVGR LHSDIDSG

DGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHEIYHANVPERSNVG GTSVIQVT

ASDADDPTYGNSAKLVYSILEGQPYFSVEAQTG GIIRTALPNMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVTITLTDVNDNPPKFPQS SVYQMSVS

EAAVPGEEVGRVKAKDPDIGENGLVTYNIVDGDGIELFEITTDYETQDGVVKLKK PVDFETKRAYSLKIEAANVHIDPKFISNGPFKDTVTVKISVEDA

DEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIR RYSIDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNISVFAAEIH HNRHQETKVP

VAIRVLDVNDNAPKFAAPYEGFICESDHPKALSNQ PIVTVSADDQDDTANGPRFIFSLPPEIMHNPNFTVRDNRD DNTAGVYARRGGFSRQKQDFYLL

PIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLSTGALIAILACIVILLV VIVVLFVTLRRQKKEPLIVFEEEDVRENIITYDDEGG

GEEDTEAFDIATLQNPDGINGFIPRKDIKPEYQYMPRPGLRPAPNSVDVDDFINTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLD

YDYLQNWGPRFKKLADLYGSKDTFDDDS

For any suggestions or comments, please send an email to unitrap@crg.es