Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031681 (Smad1)
Chromosomal location
Chr 8: 81862300 - 81923417 (-)
Description
MAD homolog 1 (Drosophila) Gene [Source:MGI (curated);Acc:Smad1-001]
RefSeq_dna
NM_008539 
RefSeq_peptide
NP_032565.2 
UniGene
Mm.422314 
MGI
MGI:109452 
Uniprot/SWISSPROT
P70340 
Uniprot/SPTREMBL
Q8CC31 Q8C3Y6 Q6GT95 
Human Ortholog
ENSG00000170365 (SMAD1)
Omim not available
UniTrap UNI30573
Vector Insertion
Chr 8: 81895682 - 81923368
Public Clones IST10124G5 (tigm) IST13014D10HMF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI461
Vector Insertion
Chr 8: 81880369 - 81895682
Public Clones DC0074 (sanger) XH848 (baygenomics)
Private Clones OST424245 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066081
Sequence
GGAGGCTGGGCGGTTCCGACTGCCTGACGCCAGCGCGACCAGATCAATCCAGGCTCGGGGAGCGAGCGGGCGCACCAAGGCGAGGCCGGGGCCGAGGCGC

GGGGACGGCGGCCCGGAGCTAAGCAGAGCGCGGGGACGGCGGCCGGGAGCGGATCGGAGCACGGGACCCGGCGCCGGGTCTCGTGCGTCCCTGCGGATGG

GCGCGCCGCCGAGCCG - UNI30573 - GCGCTAACTGGGATCCTCGCTGGAACAGGAGGGACAGTATTTTCTACCTTTCCAAACCGCAGACCAAGAA

GCTAAGGAGAATCTATGTAAATATACTGAAATCTCTGTTGGCTCTGCGCCCAACACCCCGGAGCTGGCACCTCACCCTGTCTGAGGAGCGTGTAGAACTA

GACCAGCCGCTATGAATGTGACCAGCTTGTTTTCATTCACAAGTCCAGCTGTGAAGAGACTCCTTGGGTGGAAACAGGGCGATGAAGAAGAGAAATGGGC

AGAGAAAGCTGTGGACGCTTTGGTGAAGAAACTGAAGAAGAAGAAAGGGGCCATGGAAGAGCTGGAGAAGGCCCTGAGCTGCCCTGGACAGCCGAGTAAC

TGCGTCACCATTCCTCGCTCCCTGGATGGCAGGTTGCAGGTGTCCCACCGGAAGGGACTACCTCATGTCATTTATTGCCGTGTGTGGCGCTGGCCCGACC

TCCAGAGCCACCATGAACTGAAGCCTCTGGAATGCTGTGAGTTCCCATTTGGTTCCAAGCAGAAGGAGGTCTGCATCAACCCCTACCACTATAAGCGAGT

GGAGAGCCCGG - UNI461 - - UNI30573 - TTCTCCCGCCGGTGCTGGTTCCGAGGCACAGCGAGTACAATCCTCAGCACAGCCTTCTGGCTCA

GTTCCGCAACCTGGGACAAAATGAGCCTCACATGCCACTGAACGCCACGTTCCCAGACTCTTTCCAGCAGCCCAACAGCCACCCGTTCCCCCACTCCCCC

AACAGCAGCTACCCCAACTCTCCTGGCGGCAGCAGCAGCACCTACCCTCACTCCCCAACCAGCTCAGACCCGGGCAGCCCTTTTCAGATGCCAG CTGCA

TCCTTCTGGGAGTGGCATGGTTGTTCCAGCCTCTGCTCTCCATAA
Translation
 - UNI30573 - MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHV

IYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPV - UNI461 - - UNI30573 - VLPPVLVPRHSEYNPQHSLLAQFRNLG

QNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPA AASFWEWHGCSSLCSP
Transcript ENSMUST00000109885
Sequence
GAGGGCAAGCGGCAGGCGGGTTGTGCGCCGGGTATTGGCAGGCGGGCTGTGGAGGCTGGGCGGTTCCGACTGCCTGACGCCAGCGCGACCAGATCAATCC

AGGCTCGGGGAGCGAGCGGGCGCACCAAGGCGAGGCCGGGGCCGAGGCGCGGGGACGGCGGCCCGGAGCTAAGCAGAGCGCGGGGACGGCGGCCGGGAGC

GGATCGGAGCACGGGACCCGGCGCCGGGTCTCGTGCGTCCCTGCGGATGGGCGCGCCGCCGAGCCG - UNI30573 - GCGCTAACTGGGATCCTCGC

TGGAACAGGAGGGACAGTATTTTCTACCTTTCCAAACCGCAGACCAAGAAGCTAAGGAGAATCTATGTAAATATACTGAAATCTCTGTTGGCTCTGCGCC

CAACACCCCGGAGCTGGCACCTCACCCTGTCTGAGGAGCGTGTAGAACTAGACCAGCCGCTATGAATGTGACCAGCTTGTTTTCATTCACAAGTCCAGCT

GTGAAGAGACTCCTTGGGTGGAAACAGGGCGATGAAGAAGAGAAATGGGCAGAGAAAGCTGTGGACGCTTTGGTGAAGAAACTGAAGAAGAAGAAAGGGG

CCATGGAAGAGCTGGAGAAGGCCCTGAGCTGCCCTGGACAGCCGAGTAACTGCGTCACCATTCCTCGCTCCCTGGATGGCAGGTTGCAGGTGTCCCACCG

GAAGGGACTACCTCATGTCATTTATTGCCGTGTGTGGCGCTGGCCCGACCTCCAGAGCCACCATGAACTGAAGCCTCTGGAATGCTGTGAGTTCCCATTT

GGTTCCAAGCAGAAGGAGGTCTGCATCAACCCCTACCACTATAAGCGAGTGGAGAGCCCGG - UNI461 - - UNI30573 - TTCTCCCGCCGGTG

CTGGTTCCGAGGCACAGCGAGTACAATCCTCAGCACAGCCTTCTGGCTCAGTTCCGCAACCTGGGACAAAATGAGCCTCACATGCCACTGAACGCCACGT

TCCCAGACTCTTTCCAGCAGCCCAACAGCCACCCGTTCCCCCACTCCCCCAACAGCAGCTACCCCAACTCTCCTGGCGGCAGCAGCAGCACCTACCCTCA

CTCCCCAACCAGCTCAGACCCGGGCAGCCCTTTTCAGATGCCAG CTGACACACCCCCACCTGCTTACCTGCCTCCTGAAGACCCCATGGCCCAGGATGG

CTCTCAGCCCATGGACACGAACATGATGGCGCCTCCACTGCCCGCTGAAATCAGCAGAGGAG ATGTTCAGGCAGTTGCTTACGAGGAACCAAAACACTG

GTGCTCTATTGTGTACTATGAGCTCAACAACCGTGTGGGTGAAGCGTTCCACGCCTCGTCCACCAGCGTGCTGGTGGATGGTTTCACAGATCCGTCCAAC

AATAAGAACCGCTTCTGCCTTGGCTTGCTCTCCAACGTTAACCGGAATTCCACTATTGAAAACACCAGGCGACATATTGGGAAAG GAGTCCACCTTTAT

TACGTTGGAGGAGAGGTGTATGCGGAATGCCTCAGTGACAGCAGCATCTTCGTGCAGAGCCGGAACTGCAACTACCACCACGGCTTTCACCCCACCACCG

TCTGCAAGATCCCCAGCGGGTGCAGCTTGAAAATCTTCAACAACCAAGAGTTTGCTCAGCTACTGGCGCAGTCTGTGAACCACGGGTTCGAGACCGTGTA

TGAACTCACCAAAATGTGCACTATTCGGATGAGCTTCGTGAAGGTGAGCAGTGCCCACCCGTCTCATTCGGGCTGAATGCCCCCCTCCCCCAACACACAC

ACATACTTCCCCCATACACATATGCTCACACAACACACACATGCCTTCTCACAACATGTAAATCTGTGCCTTCTTGGTGTATATATACCTATCAGCAGGC

TACTGTTGTTGTTGTTGTTGTTGTTGTTGTTTTCCAAATTTCTAACAAGAGTATCACTGTCCAAAAAGTTATTCTGGAACATAGCAATGTAATCTTTCCC

TCCCACCGTGTGGATCCCAAGGATAGACTGAGGCTTGGTAATGCTGAGGCTTGGTGGTAGGTACCTTTACCCACCTGAGCCATCTTGCGGGCCCTGGTCA

ATCTTCTGTACTTTTGAGAGAGGGTCTAACGTAGCCCAGGTAGCTGGGCTGATGCTGAGGAGGAGTTTAAAGTCCTGATCTGTCAGCTCTGCACCTGGAG

TGGCTAGGTAGGATTCTAGGCTGTGTGCTACCATTGCCCTGCCGTAAGGTCTGTGCTCTACGAGGCCAGCGCTCCACCCACTGTGCTGTGTCCCCAGCCC

CATAGCTGCTATAGTGTCTTTAACAGGTAGCTTAAATCTGTGGTCATGCTATGAGACAGCTGAATAAATGTCTTTGTTCCTCTCGTTCTTTGCTTTCAGC

ACGGTATGCACAGGAGACTTGGTGCCTAGTGACTGTAGTTCTGTAGTCAGTTATGATCTTTTAGGGCCTGTGCTCTTTTAGGTGCCTTCTGGCAGGCAGT

TTGATTCCTGGGACCCACGTGGTAGAAACAGCTCCCTCAGCTGTTCTCTGTCCTCCCCATGTGCACACACAGGGCGGGGGGTGGGGGGAGTAAATAGATG

TAGCAATTTACGCTGGAAATTATTTTCAGTTGGTCAGGTTTCTTTGTTTTGTTCTTACATATTTCTAGTAAATCATGCATTTTATGTGTAATTGAAAAGT

TAGCAAGGCCCTGGCCCTCAGCTCCAAAAGTATCTGTAATATCAAAGAAAGGAGAAGATCGGCGTCATTGCTCTTAACAGATATCTCTGTCCACTTCTGC

CATTGAGAATGAAAGTTTTTGAAGATGCCGATGAAATGTTAAAAACCAATGTGCATCTGATGGCAGCACACTCTAGCAACTGGCTCGTCTCTGAAGTCTC

CAAGATAAGTCTTTATCCCACTTCACCGTGAGGAAGAGTGCTAATTACAGACTTGGACCAGGCAGTCGTCTTTCCTGTGCCGTCTTCAGAAGCTCCGTGG

CTTGTTGCAGGGCCTGTTTAGTGGTTTGTTCATCACTGGGCGATTCCAGAGCCTTGCTTTGCTCGGCCTCCCCCAGATCAAAGGCATCCTGCCCCCTCCT

TAGCTGAATGTGGCACCTCCTTAATATTAAAAACTAGTGCCCCTTAAAGAAACTGGCCTGTATACTATGTGCAAATGTGACCAAGGAGCCAGTCCTTGTT

CACTGTTCACAAGTGCCACTTAATTTTTGACTTAGCATTTTGGTTCAGGTGATTTACCACCTACTTCACAACGTGGATTTCGTTTGGGGGAGAGGACTCT

CGAGAGTGGGGGTGTTTGAACTGTGGTCGAGGCACAGGGGCTGTTCTCAGATCTCCTTCTCATGGTCTGTAAAATGGGACTGGCTCTCACTGGGGCTTTG

GTAATTATGCCTGAAGTCCCTGATGGACTGTGATTATTGAATTCTTGAAGAAGTTTTGGCTCCAGTAAGCTGTCTCCTTGGCATTTGTTTCCTACTGATT

ACACAACTAACAGTTAAATGTTACTTTTGTACATTTAAAAAATTTTGCACTAAGGTATTTAAAGTTTTTTGTTTTGTTTTGTTTTTACTTTTATTAGTGC

ATGTATGTGTGAGCGCAATGTGTGTGTGCTGCTGGAGGTCAGAGGAGGGGGTCAGATCTCTTGGAGCAGAAGTGAGATGTAGATTGTTGTGAGCAGTCGT

GGATGCCTGGAACCAAACTCAGGTCCTCTCTTAACGGTTAAGACCTCTCTTCAGCCCAAAGCTGCAGATTCAAAATTTATTGACTTTTTTCTTTCTGCAA

ATACTTTATCATTATTC
Translation
 - UNI30573 - MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHV

IYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPV - UNI461 - - UNI30573 - VLPPVLVPRHSEYNPQHSLLAQFRNLG

QNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPA ADTPPPAYLPPEDPMAQDGSQPMDTNMMAPPLPAEISRG

D DVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKG GVHLYYVGGEVYAECLSDSSIF

VQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKVSSAHPSHSG
Transcript ENSMUST00000066091
Sequence
GGAGGCTGGGCGGTTCCGACTGCCTGACGCCAGCGCGACCAGATCAATCCAGGCTCGGGGAGCGAGCGGGCGCACCAAGGCGAGGCCGGGGCCGAGGCGC

GGGGACGGCGGCCCGGAGCTAAGCAGAGCGCGGGGACGGCGGCCGGGAGCGGATCGGAGCACGGGACCCGGCGCCGGGTCTCGTGCGTCCCTGCGGATGG

GCGCGCCGCCGAGCCG - UNI30573 - GCGCTAACTGGGATCCTCGCTGGAACAGGAGGGACAGTATTTTCTACCTTTCCAAACCGCAGACCAAGAA

GCTAAGGAGAATCTATGTAAATATACTGAAATCTCTGTTGGCTCTGCGCCCAACACCCCGGAGCTGGCACCTCACCCTGTCTGAGGAGCGTGTAGAACTA

GACCAGCCGCTATGAATGTGACCAGCTTGTTTTCATTCACAAGTCCAGCTGTGAAGAGACTCCTTGGGTGGAAACAGGGCGATGAAGAAGAGAAATGGGC

AGAGAAAGCTGTGGACGCTTTGGTGAAGAAACTGAAGAAGAAGAAAGGGGCCATGGAAGAGCTGGAGAAGGCCCTGAGCTGCCCTGGACAGCCGAGTAAC

TGCGTCACCATTCCTCGCTCCCTGGATGGCAGGTTGCAGGTGTCCCACCGGAAGGGACTACCTCATGTCATTTATTGCCGTGTGTGGCGCTGGCCCGACC

TCCAGAGCCACCATGAACTGAAGCCTCTGGAATGCTGTGAGTTCCCATTTGGTTCCAAGCAGAAGGAGGTCTGCATCAACCCCTACCACTATAAGCGAGT

GGAGAGCCCGG - UNI461 - - UNI30573 - TTCTCCCGCCGGTGCTGGTTCCGAGGCACAGCGAGTACAATCCTCAGCACAGCCTTCTGGCTCA

GTTCCGCAACCTGGGACAAAATGAGCCTCACATGCCACTGAACGCCACGTTCCCAGACTCTTTCCAGCAGCCCAACAGCCACCCGTTCCCCCACTCCCCC

AACAGCAGCTACCCCAACTCTCCTGGCGGCAGCAGCAGCACCTACCCTCACTCCCCAACCAGCTCAGACCCGGGCAGCCCTTTTCAGATGCCAG CTGAC

ACACCCCCACCTGCTTACCTGCCTCCTGAAGACCCCATGGCCCAGGATGGCTCTCAGCCCATGGACACGAACATGATGGCGCCTCCACTGCCCGCTGAAA

TCAGCAGAGGAG ATGTTCAGGCAGTTGCTTACGAGGAACCAAAACACTGGTGCTCTATTGTGTACTATGAGCTCAACAACCGTGTGGGTGAAGCGTTCC

ACGCCTCGTCCACCAGCGTGCTGGTGGATGGTTTCACAGATCCGTCCAACAATAAGAACCGCTTCTGCCTTGGCTTGCTCTCCAACGTTAACCGGAATTC

CACTATTGAAAACACCAGGCGACATATTGGGAAAG GAGTCCACCTTTATTACGTTGGAGGAGAGGTGTATGCGGAATGCCTCAGTGACAGCAGCATCTT

CGTGCAGAGCCGGAACTGCAACTACCACCACGGCTTTCACCCCACCACCGTCTGCAAGATCCCCAGCGGGTGCAGCTTGAAAATCTTCAACAACCAAGAG

TTTGCTCAGCTACTGGCGCAGTCTGTGAACCACGGGTTCGAGACCGTGTATGAACTCACCAAAATGTGCACTATTCGGATGAGCTTCGTGAAG GGTTGG

GGAGCCGAATACCACCGGCAGGATGTTACCAGCACCCCCTGCTGGATTGAGATCCATCTGCATGGCCCTCTCCAGTGGCTGGATAAGGTTCTGACCCAGA

TGGGCTCACCCCACAATCCTATTTCATCCGTGTCTTAAAAGACCTGTGGCTTCCGTCTCTTGCAAACTATCGAGCCTTGCATGTACTTGAAGGATGGACA

AGTCAGACAGGATGGAGACCTGACGAAGGAGCCACGATAATACTTGACCTCTGTGACCAACTATTGGATTGAGAAACTGACAAGCCTTGGTTGATAGCAA

GAACCCTTTCAGTTTACATTGTGACATTCTGTTGTAAAAATCAACTAAAATGCTGACTTTCAGCAGGACTTTTGTGTATAGTTAAAAAAAAAAGAGATGG

CCAAGCCAGGGACAAATTATCTATTAGGAAAAAAGAAAAAAATGATTGTAATCAATCCTTTTGTGTGGGGTGTTGGCAGAAGGTTGGCGCTGATAGTCTT

TCTGAAGTGGGCTTTCATCAGGCTCAGAGCCCACGTTGAATCATCTTCTCATGGGTTTTCTTAATATTTTAAAACTACTTGTTTAGAAATGAATGGGTTT

TTTGTTTGTTTTTAAAGTACAGGTTAATCGTTATGACATGCATAGTAATCTTTCTGAAACTGTATGCTGGCTGTATTACTGTCAGAATGATGGCAGGCAT

ATGCTCTTTGCTAAATATGTATATACAGAATATTTGGAGGTTATGAATAGTCTAAATGGCTAGTGGGTTTACAGAGTATCTGAGGGGCGGGGTCGGGAAG

AAAACGACGGCTGCAAATGTAGACTATACCGTAAAGCTCAGCTTGCTGCCTTAAACAGACAAGCTGGTGTCTGAATTTGCTGTGTTTCAGTTTTTGTAGA

GTTTTATCTGACTTCTTTTCTTCTGTCTTATCCGCTCCACGGCACAGTTAAGCAGCTGGTTAATTCCTCTAACTGTGAGAGCAGATGAGTAATTCCTTCT

GTTCGCAAATCAACTGGCTTCGTGTTTCAGTACCCAGTATATGAAAAGCTTGAATTGAATGAGCAGTTTTTATGGAGTTTACAGTACAGACATAGGCTTT

GATTTCCAAATAAATTGTTTGCCAAACCTGGTAACTCTGTTCATTATTCGCAGGATTAAAGATCTCTCTATTGGAATCCATTTCAAAGGTTGTTTTTTTT

GTTTTTGTTTTTGTTTTTTGTTTTATTTTGATTTGTTTTTTTTTGTACTATTTGGTTTCTTTTCTTCTGTTAATTTTTTTATTCTCCTTTGCTCTTATAC

AGCGAGTACTTTTATTCCAACACTAGCAGGGTTTTTCTCTACTGGAAATTTTTAAATAAAACCTGTCATTATTGCTTACTTTGATT
Translation
 - UNI30573 - MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHV

IYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPV - UNI461 - - UNI30573 - VLPPVLVPRHSEYNPQHSLLAQFRNLG

QNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPA ADTPPPAYLPPEDPMAQDGSQPMDTNMMAPPLPAEISRG

D DVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKG GVHLYYVGGEVYAECLSDSSIF

VQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVK GWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQ

MGSPHNPISSVS

For any suggestions or comments, please send an email to unitrap@crg.es