Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031682 (1700011L22Rik)
Chromosomal location
Chr 8: 81734330 - 81772469 (-)
Description
RIKEN cDNA 1700011L22 gene Gene [Source:MGI Symbol;Acc:MGI:1914937]
MGI
MGI:1914937 
Uniprot/SPTREMBL
Q9DAF8 
Human Ortholog
not available
Omim not available
UniTrap UNI28487
Vector Insertion
Chr 8: 81734657 - 81737376
Public Clones not available
Private Clones OST29850 (lexicon) OST17279 (lexicon) OST4365 (lexicon) OST2007 (lexicon)
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034109
Sequence
GTCGGGCTTCAGAAGTCTAGTCAGCCCAGTCAAGAGCTTCCTGCAACTAGGAGGGAATGAGCGCCTCGCTCTGCCCAGGGCTTGAAAAGCTGTTGCTCAC

AGCTGCCCGCCCATAGCCATGACACACTTCTTGTACTTGACTCCAGAAATCCTGCTTCCCTTTAGCCCTCTCACTTCTACAGAGTTCGAACTGATCAGAC

GCAAGGCCCAACAACTGTGGCAGGATGAGACACGGTGGTCTGCTTCTTCCATGACAACCTACTCAGGGAGTTACCGGGAAAAGCAACTGGACGAGGCCAC

CTGCAACCGGCTGGCCCAGAGAGTAGGCCAGCCGCAGTTTGAGTACAAACC AACACCATTGCCAGGCAGCTCTGCCTACAACACTCTACCCGGCCACGC

TGGTTCCCAAGAGGCTGCAGATGGCAAAG GAAGACTCCCTGATATAGCAAGCCCCTCCAGGGACAGCCCACTGAACATCAAGCACAAAGTG GCACATC

AGATTTGGGGTTCTGAAGTCCCTTGTCCAACATTTCTAGCTTACAGAGGTCTCCGTATGTCCCCCT GTATGCAGCCCAAAAAGCCAGGCTTTGAGCTCC

TCATGAGTTACAGGAACAGAGGGAAGGCCCTGCTGAAACGG - UNI28487 - CTTCAGCGACAATGGGATTATGAAAGCAAGTTGGGCTCCTCGGAG

GACTCAGGGACGGATCGATTCTCCTCCAATACCAGTGGAAGCTCAGGGCGCAAATTCAAGTGATTTCAAGAAAGAAGCCACAGACCTAGAGCCCTACCTC

GTGTCTGTGTTAAGCCATTGAGACAGGAGTTCCAAGAAGGCTTTGATGGATTGTGCACATAGGGAAGATCTTGCTAGAAACTTCCCTGGGCTTCCTCCCT

TATTCTTGTGTGTGTGCGCGCGCACACACGCACGTGTGTTGATGGGGAAGGGGTTTGTCATAAACATGATTAATGTTCCTTT
Translation
MTHFLYLTPEILLPFSPLTSTEFELIRRKAQQLWQDETRWSASSMTTYSGSYREKQLDEATCNRLAQRVGQPQFEYKP PTPLPGSSAYNTLPGHAGSQE

AADGKG GRLPDIASPSRDSPLNIKHKV AHQIWGSEVPCPTFLAYRGLRMSPC CMQPKKPGFELLMSYRNRGKALLKR - UNI28487 - LQRQWD

YESKLGSSEDSGTDRFSSNTSGSSGRKFK

For any suggestions or comments, please send an email to unitrap@crg.es