Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031683 (Lsm6)
Chromosomal location
Chr 8: 81330350 - 81345039 (-)
Description
LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1925901]
RefSeq_dna
NM_030145 
RefSeq_peptide
NP_084421.1 
UniGene
Mm.28694 Mm.400222 Mm.415220 
MGI
MGI:1925901 
Uniprot/SWISSPROT
P62313 
Uniprot/SPTREMBL
Q542U7 
Human Ortholog
not available
Omim not available
UniTrap UNI35014
Vector Insertion
Chr 8: 81336874 - 81345040
Public Clones (sanger) IST14729E8 (tigm) IST13438E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000051867
Sequence
GAGATGGGAAAGCCGCTGCCGGGGGCGGTTTCGGTTTTCGGCGCGCGCGTCCGCGGAAGCCCGGCCTGTGAGCGTTCTGGATCCGGCTGCAAG - UNI3

5014 - GGTTGTTAAACATGAGCCTGCGGAAGCAAACCCCTAGCGACTTCTTAAAGCAGATCATCGGACGGCCAGTTGTGGTGAAATTAAATTCTGGCG

TGGATTATCGAG - UNI35014 - GGGTCCTGGCCTGCCTGGATGGCTACATGAATATAGCCCTGGAACAGACAGAGGAGTATGTAAATGGACAGCTG

AAGAATAAGTACGGAGATGCGTTCATCCGAGGAAACAATG TGCTGTACATAAGTACACAGAAGAGGCGGATGTGAAGACACCAGGAGGCAGTGCTCTTC

AGAGATGGATAGATGAAGTGGTTTTGGTTCTCTTACCATCTTAGTTGGCCTGTTTTCATGGTGGCTGGTGGGGGTTTGTTTGTTTGTTTGTTTAATTGAC

ATTGGAATAAGATAGAGGTATTGCATTACAGATCGACTCTTAAGTTTTTCACATTTATGTCTCAGTCTTTATCATTTCTGCCTGTACAGAATGCTAAAAC

TAAAACAGTTTGTTTCTCCAGGATTATTTTACCTAAGATTCCTGCCCTGTCATTCCATTGGTTGATTACGTATTCAGCTGACTAAGTGGTACATCCCGGA

ACCTGTGATCAAGCATTCTGGAGGCATCCTTTGTCTCTTTCTCTACTCACCATCCGTACCATTTAAAGCAGGTAGATAGAAAGTCATATGGTTTCAGCCT

TGGGCTATAAAGGGACAAGAGGTCAGAAAATCAGCTGTTTATTTAGTCACCTAGTTAGTGGTGGTATCTCCACAAAGGAGTGCAACTGTAGAGTCAGGAA

TTGGAAAGGTCAGCCACGTGAGGTGAGACACTGCCTGGAAGCCTCCTGTGCAGTTAGACTCTTCATGTTAACTTGCTCCCTGTTGAGAGTGTTGGTGCAA

TGGCTGGTTACGCCAGCCAGGGGAGGAGCTCTACTGTTCCTGAGAAACTGGCTGTGGCTGAGGTGGTGCAAGCCCAGAGTGCTTAGACTCAGTTTCCAGG

CACTGAGCTTCGGCTGCGAAAGTTTCTCCTGCTTTTTGCTTTAGCAAGTGGCCTTGGGGAAAGGGTTGTATTCTTGGCCTTCAGGTCACGTGACTCCCGC

TGAGCGGGCTTGTGCTGTCTGTGGACTGTGTGTGGGTGCTTTGGTTGCATGGACGCTAGGGCTTTCCTTACCCTCCTTCAATCTAAACAGATCCCTGTCT

CGGGAGGTCGGACAGTTTTAGAGCAATTGCCCGGCTGGAGGAAGTGGAGGCAGATGGACAGCTAAGGAGGGAGGGTGTGCTTTCTGGAGAGGTGTATATA

TGGCATTTGTCTAATTTAAATAGTAATCAGAAACAATTAATAACTCAGGAAAGAGAGGAGTAAGGTTTGATGGTGTGCACACTGAAAATAAAACACTTTA

TCCTAAGCTTCAGTAATTCATCACTTCCTGACAGGGGCTTGCAAAGGCACCAGTGTGTAAGTACAAATCACCAATTTGCTCTTTTATAAATGGCTTCTTT

AAAGGAGAAAATGGATGTCTCTCGGAGTGGAGCACACATGTTCTCATTTGTTTTTTAGAGTGTGTGAGGCCGCCAGGTTACTGCATCCCTTCATTCATCC

CCTCAGCTGCCCTGAAAGCAGCCCTGCTGTTATCTCCAGCAGTCTGTAACATCCCGGCTCTGCTCATTTCTTCCCTGACCTCCCCTCCAGCCTGCAGGTC

TTTATTTCCCTCTTGCCATTTCTAGCTTAATAGCGCTACTGCAGAATATTGTTTTCATCCATGGAACCGCTTTTAATCAAGATGGACTTTGGGAAATGCT

ACCATTTTTATGGTAATAACCATATTATGCATCTGGACCAGCACATGTTGTCCCCTGTGCATACCTTCTTGTGATAGAATTCTGAAACAAATTGTAAATG

GTAAAATTACTTTTTTTTTAACTGTAGTCTCCTCGTGGTCTGTGAATGGTTTTCAGTTGGATGGTAGCAAAGACAATTGTTGTAGGGTGAAAATTTTTCA

CTTGAGTAAATACATTTTCCGTGTCCCTATGCCCCC
Translation
 - UNI35014 - MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRG - UNI35014 - GVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV 

VLYISTQKRRM

For any suggestions or comments, please send an email to unitrap@crg.es