Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031684 (Slc10a7)
Chromosomal location
Chr 8: 81033267 - 81257902 (+)
Description
solute carrier family 10 (sodium/bile acid cotransporter family), member 7 Gene [Source:MGI Symbol;Acc:MGI:1924025]
RefSeq_dna
NM_029736 
RefSeq_peptide
NP_084012.1 
UniGene
Mm.334631 Mm.473543 
MGI
MGI:1924025 
Uniprot/SWISSPROT
Q5PT53 
Uniprot/SPTREMBL
Q5PT52 
Human Ortholog
ENSG00000120519 (SLC10A7)
Omim not available
UniTrap UNI11100
Vector Insertion
Chr 8: 81033266 - 81033574
Public Clones G054E07 (ggtc) G002D01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27250
Vector Insertion
Chr 8: 81033574 - 81039484
Public Clones (sanger) E324D03 (ggtc) E325G04 (ggtc) D131B03 (ggtc) IST12086A2 (tigm)
IST10117E2 (tigm) IST12947B2 (tigm)
Private Clones OST65758 (lexicon) OST57200 (lexicon) OST29589 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20548
Vector Insertion
Chr 8: 81039568 - 81049060
Public Clones IST12428B2 (tigm)
Private Clones OST359049 (lexicon) OST352748 (lexicon) OST350667 (lexicon) OST262751 (lexicon)
OST211291 (lexicon) OST203834 (lexicon) OST190881 (lexicon) OST188654 (lexicon)
OST136526 (lexicon) OST63301 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30536
Vector Insertion
Chr 8: 81055058 - 81102617
Public Clones IST11061B9 (tigm) IST12511D10 (tigm) IST10581C6 (tigm) IST14782F6 (tigm)
IST12767A11BBF1 (tigm) IST12878C12 (tigm) IST10160F3 (tigm) IST11831C3 (tigm)
IST14950G7 (tigm) IST10752G3 (tigm) IST10741G11 (tigm) IST11471B5 (tigm)
IST10667C1 (tigm) IST14225A12 (tigm) IST10255D3BBF1 (tigm) IST14067F10 (tigm)
IST14837C12 (tigm) IST10222H11 (tigm) IST10208B11 (tigm) IST12124B7HMR1 (tigm)
IST12012E11 (tigm) IST10685F5 (tigm) IST12041F2 (tigm) IST12415H10 (tigm)
IST10111F6 (tigm) IST10906H9 (tigm) IST10140A1 (tigm) IST12159C7HMR1 (tigm)
IST10531C10 (tigm) IST10662A4 (tigm) IST11557D6 (tigm) IST10118G6 (tigm)
IST10739E6 (tigm) IST10600A12 (tigm) IST10255D3 (tigm) IST14771E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17363
Vector Insertion
Chr 8: 81102617 - 81102657
Public Clones not available
Private Clones OST443871 (lexicon) OST347309 (lexicon) OST330005 (lexicon) OST323266 (lexicon)
OST168786 (lexicon) OST43269 (lexicon) OST40614 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31932
Vector Insertion
Chr 8: 81102657 - 81186885
Public Clones IST10994B5 (tigm) IST14887F11 (tigm) IST12674E4 (tigm) IST12440D9 (tigm)
IST12540H3 (tigm) IST10722H12 (tigm) IST12460C3 (tigm) IST10903A4 (tigm)
IST10361G8 (tigm) IST11384B10 (tigm) IST10895D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1779
Vector Insertion
Chr 8: 81186885 - 81186922
Public Clones CE0352 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31097
Vector Insertion
Chr 8: 81186922 - 81210483
Public Clones IST14566F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17183
Vector Insertion
Chr 8: 81210483 - 81210568
Public Clones not available
Private Clones OST447871 (lexicon)
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20474
Vector Insertion
Chr 8: 81210568 - 81221064
Public Clones not available
Private Clones OST361069 (lexicon) OST175213 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16508
Vector Insertion
Chr 8: 81253516 - 81253663
Public Clones not available
Private Clones OST459556 (lexicon) OST56452 (lexicon) OST41273 (lexicon) OST41272 (lexicon)
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9859
Vector Insertion
Chr 8: 81253663 - 81255507
Public Clones XB479 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093416
Sequence
TGCATGTCTGGAGGGATCGAGGAAAGTGTGGAGACGCCCCGGGGATTTAGGGATCGCAGTTTGGAAAGCAAGCCAGCCAAACAAATAAACAAAACCCACC

CGCCCTAACAAATATGAGGCTGCTGGAGAGGGCGAGGAAAGAATGGTTCATGGTCGGGATAGTGGTGGCGATCGGCGCCGCTAAGCTCGAGCCGTCGGTC

GGAGTGAACGGGG - UNI11100 - - UNI20548 - - UNI27250 - GAGCTGACCAGCGCACTGGTGCACCTGAGACTGCATCTTTTCATCCA

AATCTTCACACTTGCCTTCTTCCCAGCAGCAATATGGCTCTTTCTTCAGCTCTTATCAGTCACATCCATCAACGAGTGGCTTTTAAAAGG TCTGCAGAC

AGTAGGTTGCATGCCACCCCCTGTGTCTTCTGCCGTGATTTTAACCAAGGCAGTTGGTGGAAATGAG - UNI17363 - - UNI30536 - GCAGCT

GCGATATTTAATTCAGCATTTGGAAGTTTTTTG - UNI1779 - - UNI17363 - - UNI31932 - GGCATTGTTGTGACTCCGGTGCTCCTGC

TGCTTTTC - UNI1779 - - UNI17183 - - UNI31097 - CTCGGTTCATCCTCTTCGGTGCCTTTTACATCCATTTTCTCTCAGCTGTTTAT

GACGGTGGTGGTTCCTCTTGTCATTGGACAG - UNI17183 - - UNI20474 - ATCGTCCGACGCTACATCAAGGACTGGCTGGAGAGGAAGAAG

CCACCATTTGGTGTGGTCAGCAGTAGCGTGCTACTCATGATCATCTACACCACCTTCTGTGACACCTTCTCCAACCCAAACATCGACCTGGACAAGTTCA

GCCTCATCCTCATACTGTTCATAA TAGTCTCCGTTCAGCTGAGCTTCATGCTTCTGACTTTCATCTTCTCCACACG GAATAACTCGGGGTTCACACCA

GCAGACACAGTGGCTATCATCTTCTGCTCCACACACAAGTCCCTCACCTTGG - UNI16508 - GAATCCCAATGCTGAAGATAGTGTTTGCAGGCCA

TGAGCATCTCTCGCTGATATCCGTGCCCTTGCTCATCTACCACCCAGCTCAGATTCTCCTGGGAAGTGTGTTAGTGCCAACAATAAAGTCTTGGATGGTG

TCCAGGCAGAAG - UNI9859 - - UNI16508 - GGAGTGAAGCTGACAAGGCCGACAGTGTGACTCGGGTGGCGCCAGCCTTCCTGGAGTGTGTA

CATATATGTACAGGCTGTACATACAGGGGTTCTGAGGACCTGTCCTTGGGGATGCTGCTTTGATGCCTATTTTATTTTTTTACAGAAAAAAATATGATAT

ACCTGTTTAAGTGCCTTACGATGTTTTTGACAAGAGCGTTATTTCCAAAACACACTCTGTTGGCTACTGCCAAGGGTAGTACAGTATTTTGGACTCATTT

TTTTCCCTAAGGCAGAAAAAAAAGTTCTAGTAAGGGACAAAAGCTAACACGTTTTCTTCGTACTGCCTTTGTGCAGGCAAGACTCTAATAGCACTATAAC

GTTCAAAATGAGGTCATGCCATCCAGAAACCTCCCTCCTGGTGACAGTGAACGATTCCAAAGTCTCATTCACCGCACACTTTGATTCACCGAGTGGTTCT

TTGTTTCTAAGACTGTGACGGGCTCTTCCTTATCAACTCAGCGGGGGATGCAGATCGCAGAGATGCCGAGAAGCGTCAGGT
Translation
MRLLERARKEWFMVGIVVAIGAAKLEPSVGVNGG - UNI11100 - - UNI20548 - - UNI27250 - GADQRTGAPETASFHPNLHTCLLPSS

NMALSSALISHIHQRVAFKR SADSRLHATPCVFCRDFNQGSWWK - UNI17363 - - UNI30536 -  - UNI1779 - - UNI17363 - - 

UNI31932 -  - UNI1779 - - UNI17183 - - UNI31097 -  - UNI17183 - - UNI20474 -    - UNI16508 -  - UNI9

859 - - UNI16508 - 
Transcript ENSMUST00000034111
Sequence
CTGTCACTGGGTACTACTACTCCCAGCCCGCCTCGGAGCCGCCCGAGCCACCCCTCGGTCTTTAGTTTACGAGTGGCAATTTGACTTGCTCTGCTGCATG

TCTGGAGGGATCGAGGAAAGTGTGGAGACGCCCCGGGGATTTAGGGATCGCAGTTTGGAAAGCAAGCCAGCCAAACAAATAAACAAAACCCACCCGCCCT

AACAAATATGAGGCTGCTGGAGAGGGCGAGGAAAGAATGGTTCATGGTCGGGATAGTGGTGGCGATCGGCGCCGCTAAGCTCGAGCCGTCGGTCGGAGTG

AACGGGG - UNI11100 - - UNI27250 - GACCACTGAAGCCAGAGATAACTGTGTCCTACATTGCCGTCGCAACGATATTCTTCAACAGTGGAC

TGTCATTAAAAACGGAG - UNI20548 - GAGCTGACCAGCGCACTGGTGCACCTGAGACTGCATCTTTTCATCCAAATCTTCACACTTGCCTTCTTC

CCAGCAGCAATATGGCTCTTTCTTCAGCTCTTATCAGTCACATCCATCAACGAGTGGCTTTTAAAAGG TCTGCAGACAGTAGGTTGCATGCCACCCCCT

GTGTCTTCTGCCGTGATTTTAACCAAGGCAGTTGGTGGAAATGAG - UNI17363 - - UNI30536 - GCAGCTGCGATATTTAATTCAGCATTTG

GAAGTTTTTTG - UNI1779 - - UNI17363 - - UNI31932 - GGCATTGTTGTGACTCCGGTGCTCCTGCTGCTTTTC - UNI1779 - -

 UNI17183 - - UNI31097 - CTCGGTTCATCCTCTTCGGTGCCTTTTACATCCATTTTCTCTCAGCTGTTTATGACGGTGGTGGTTCCTCTTGTC

ATTGGACAG - UNI17183 - - UNI20474 - ATCGTCCGACGCTACATCAAGGACTGGCTGGAGAGGAAGAAGCCACCATTTGGTGTGGTCAGCA

GTAGCGTGCTACTCATGATCATCTACACCACCTTCTGTGACACCTTCTCCAACCCAAACATCGACCTGGACAAGTTCAGCCTCATCCTCATACTGTTCAT

AA TAGTCTCCGTTCAGCTGAGCTTCATGCTTCTGACTTTCATCTTCTCCACACG GAATAACTCGGGGTTCACACCAGCAGACACAGTGGCTATCATCT

TCTGCTCCACACACAAGTCCCTCACCTTGG - UNI16508 - GAATCCCAATGCTGAAGATAGTGTTTGCAGGCCATGAGCATCTCTCGCTGATATCC

GTGCCCTTGCTCATCTACCACCCAGCTCAGATTCTCCTGGGAAGTGTGTTAGTGCCAACAATAAAGTCTTGGATGGTGTCCAGGCAGAAG - UNI9859

 - - UNI16508 - GGAGTGAAGCTGACAAGGCCGACAGTGTGACTCGGGTGGCGCCAGCCTTCCTGGAGTGTGTACATATATGTACAGGCTGTACAT

ACAGGGGTTCTGAGGACCTGTCCTTGGGGATGCTGCTTTGATGCCTATTTTATTTTTTTACAGAAAAAAATATGATATACCTGTTTAAGTGCCTTACGAT

GTTTTTGACAAGAGCGTTATTTCCAAAACACACTCTGTTGGCTACTGCCAAGGGTAGTACAGTATTTTGGACTCATTTTTTTCCCTAAGGCAGAAAAAAA

AGTTCTAGTAAGGGACAAAAGCTAACACGTTTTCTTCGTACTGCCTTTGTGCAGGCAAGACTCTAATAGCACTATAACGTTCAAAATGAGGTCATGCCAT

CCAGAAACCTCCCTCCTGGTGACAGTGAACGATTCCAAAGTCTCATTCACCGCACACTTTGATTCACCGAGTGGTTCTTTGTTTCTAAGACTGTGACGGG

CTCTTCCTTATCAACTCAGCGGGGGATGCAGATCGCAGAGATGCCGAGAAGCGTCAGGTACCTCATTCCTTGACACCGTCTTCTTCCATCCATCCCCGCA

CACTCCAGAAACACTTCAGTCCCAGCACAGAGTGTGTGTGGGGGCTGGGGGGGGGGGGGGGAGTGCAGCTTAGATGTATTATCGGCTGCTTCAGAGAAAG

TCCTGGTGAGTGTTGCCGTGAACTCGGACAGTGCTTTGGGACGTCTGCAATCGTACCTCAGTATGCTTCTCCCTTCCATCATTCCTTAGTTTCCCATTTT

ACTTACACACAACATCCCCGTGCAACACCCAAATGTCACAGTCAGCTGGAGAGTCACAGAAATCAACAGTGGATTATGTGTTCACATTCCACAGCTGGTT

CCAAGCACATTCCTGTTACACTGTTCCAAATCGTTCCTGTTGGCAAGACACAACCTGTTACATTAAGCGCACTTGAGACATCTGAGAAGATTTATGAATC

ATTTGACAGATGTTCACAACATCTCTTAAGAAATCAAATCCTATCGCCTTAGGAGCCAGAGAAAATAAACATGAGGCCGTGGGCATGAGCTAATGTTACA

TGTCCACACTGCTAGTCAGGTGGAAGAAGGGCTGGTCCAGAAGAGCAGGCAGGACCTTCCACTCACCGAGCTGTCAACAGGATGAGTCCGGGAACTGGGC

ACCAGCTTTGGAAAGGACTCCAGAAAAGCCTACGCTGAACCCAAACAAGAAGCTAAAGCAGCATACTGAACAGTGGTGGGAGCGTCTTTCCTGAGCTTCC

TGCTTAGTGTTGGAACAGGCATCACGGGTCTCCCCAGCAGCTGCCTTTGCTGTTGGTAGTGGGGGCTGTGGACCCACAATCAATCATTCCTTCAGAATTC

CCTGGGCTTTTCAGTGGTGTTGGGTTATGTTATGGTTAGCATTGGTGTTGTAGATGATGGTAGTTTATGTCATAGTTACCGTGGTTGGCGCTGGTGTTAT

GGTGTTAGCACCAGGTCCTCTGTGTCACTGTCTCGGGACTTCATAATTCTGAGCATAGCTATAACACTGGTGTCAGGCCTGGCAGAGATCCACGCTGCAC

GGCCTGTGGGGACCATGCTGGGGACGAGGAGGCAGTGAGTCTGTTTGGTGAGTGTGCTGCCTCCATGGAGCACAAAGGTTTTCAAGTCTCACCCCCACAG

CCTTGGGGCTTTAGAGGAAGTAGACACTGTCTGCCTGCCAGAGTTGTAGACGCAACCCTTCCGTCATTTGAACACTGGTTTCCCCGCCGACCACATCTAC

CTCTCTGTGCGTGACTGCGACAAAGTTCAACTGAAGATGCTATGGTAACTTTTTCTCTTTTGCTTTAAAACTGTCTTTTGTTTTCAAACAAAACTGATTT

ATATCATGAGTTTTGGGAGCTTTAGTAACATGTCTGTGGCTACTTCTCCTTTTACACAAATATGATAGCATATTTTTCATGGTAAGGAAAAAAATAAAAT

CAAAATTTGCTTTAATTTATGCTCATTAGGATTGAACTGTCAGCTTAAAATACTTTCTATGTTTCTGCACTGCCAATGTCTGTTTTATGTATTTGTTTGT

CCAAATGTACCTATAAAAAGAATACATTAGACAGTTATGTTTACTCATTCCAACCTGGAATTGGTTTTAAACGGCTGGAACTTTAAGGAACGGCACTGCA

GTCTTTACGCATGTTACAAACGTTAAGGTTCTGTGGATTTTTTAAATTCTTCCCTATTCTGTTTTAAACTGGCACACCTCTGGTTGACGCTCAGTGTTTA

TGCTAAAAACCAAATTTTTTCAAAGAGATGGCTAAGTAATTAAGTGGGTTATTTATAATGAATGGAAAATTTAAAAAAAAAATTCTATGATTAAACAGAG

AGTACTTGACG
Translation
MRLLERARKEWFMVGIVVAIGAAKLEPSVGVNGG - UNI11100 - - UNI27250 - GPLKPEITVSYIAVATIFFNSGLSLKTE - UNI20548

 - ELTSALVHLRLHLFIQIFTLAFFPAAIWLFLQLLSVTSINEWLLKG GLQTVGCMPPPVSSAVILTKAVGGNE - UNI17363 - - UNI30536

 - AAAIFNSAFGSFL - UNI1779 - - UNI17363 - - UNI31932 - GIVVTPVLLLLF - UNI1779 - - UNI17183 - - UNI31

097 - LGSSSSVPFTSIFSQLFMTVVVPLVIGQ - UNI17183 - - UNI20474 - IVRRYIKDWLERKKPPFGVVSSSVLLMIIYTTFCDTFSN

PNIDLDKFSLILILFII IVSVQLSFMLLTFIFSTR RNNSGFTPADTVAIIFCSTHKSLTLG - UNI16508 - GIPMLKIVFAGHEHLSLISVPLL

IYHPAQILLGSVLVPTIKSWMVSRQK - UNI9859 - - UNI16508 - GVKLTRPTV
Transcript ENSMUST00000109899
Sequence
CTGTCACTGGGTACTACTACTCCCAGCCCGCCTCGGAGCCGCCCGAGCCACCCCTCGGTCTTTAGTTTACGAGTGGCAATTTGACTTGCTCTGCTGCATG

TCTGGAGGGATCGAGGAAAGTGTGGAGACGCCCCGGGGATTTAGGGATCGCAGTTTGGAAAGCAAGCCAGCCAAACAAATAAACAAAACCCACCCGCCCT

AACAAATATGAGGCTGCTGGAGAGGGCGAGGAAAGAATGGTTCATGGTCGGGATAGTGGTGGCGATCGGCGCCGCTAAGCTCGAGCCGTCGGTCGGAGTG

AACGGGG - UNI11100 - - UNI27250 - GACCACTGAAGCCAGAGATAACTGTGTCCTACATTGCCGTCGCAACGATATTCTTCAACAGTGGAC

TGTCATTAAAAACGGAG - UNI20548 - GAGCTGACCAGCGCACTGGTGCACCTGAGACTGCATCTTTTCATCCAAATCTTCACACTTGCCTTCTTC

CCAGCAGCAATATGGCTCTTTCTTCAGCTCTTATCAGTCACATCCATCAACGAGTGGCTTTTAAAAGG TCTGCAGACAGTAGGTTGCATGCCACCCCCT

GTGTCTTCTGCCGTGATTTTAACCAAGGCAGTTGGTGGAAATGAG - UNI17363 - - UNI30536 - GCAGCTGCGATATTTAATTCAGCATTTG

GAAGTTTTTTG - UNI1779 - - UNI17363 - - UNI31932 - GGCATTGTTGTGACTCCGGTGCTCCTGCTGCTTTTC - UNI1779 - -

 UNI17183 - - UNI20474 - - UNI31097 - ATCGTCCGACGCTACATCAAGGACTGGCTGGAGAGGAAGAAGCCACCATTTGGTGTGGTCAG

CAGTAGCGTGCTACTCATGATCATCTACACCACCTTCTGTGACACCTTCTCCAACCCAAACATCGACCTGGACAAGTTCAGCCTCATCCTCATACTGTTC

ATAA TAGTCTCCGTTCAGCTGAGCTTCATGCTTCTGACTTTCATCTTCTCCACACG GAATAACTCGGGGTTCACACCAGCAGACACAGTGGCTATCAT

CTTCTGCTCCACACACAAGTCCCTCACCTTGG - UNI16508 - GAATCCCAATGCTGAAGATAGTGTTTGCAGGCCATGAGCATCTCTCGCTGATAT

CCGTGCCCTTGCTCATCTACCACCCAGCTCAGATTCTCCTGGGAAGTGTGTTAGTGCCAACAATAAAGTCTTGGATGGTGTCCAGGCAGAAG - UNI98

59 - - UNI16508 - GGAGTGAAGCTGACAAGGCCGACAGTGTGACTCGGGTGGCGCCAGCCTTCCTGGAGTGTGTACATATATGTACAGGCTGTAC

ATACAGGGGTTCTGAGGACCTGTCCTTGGGGATGCTGCTTTGATGCCTATTTTATTTTTTTACAGAAAAAAATATGATATACCTGTTTAAGTGCCTTACG

ATGTTTTTGACAAGAGCGTTATTTCCAAAACACACTCTGTTGGCTACTGCCAAGGGTAGTACAGTATTTTGGACTCATTTTTTTCCCTAAGGCAGAAAAA

AAAGTTCTAGTAAGGGACAAAAGCTAACACGTTTTCTTCGTACTGCCTTTGTGCAGGCAAGACTCTAATAGCACTATAACGTTCAAAATGAGGTCATGCC

ATCCAGAAACCTCCCTCCTGGTGACAGTGAACGATTCCAAAGTCTCATTCACCGCACACTTTGATTCACCGAGTGGTTCTTTGTTTCTAAGACTGTGACG

GGCTCTTCCTTATCAACTCAGCGGGGGATGCAGATCGCAGAGATGCCGAGAAGCGTCAGGTACCTCATTCCTTGACACCGTCTTCTTCCATCCATCCCCG

CACACTCCAGAAACACTTCAGTCCCAGCACAGAGTGTGTGTGGGGGCTGGGGGGGGGGGGGGGAGTGCAGCTTAGATGTATTATCGGCTGCTTCAGAGAA

AGTCCTGGTGAGTGTTGCCGTGAACTCGGACAGTGCTTTGGGACGTCTGCAATCGTACCTCAGTATGCTTCTCCCTTCCATCATTCCTTAGTTTCCCATT

TTACTTACACACAACATCCCCGTGCAACACCCAAATGTCACAGTCAGCTGGAGAGTCACAGAAATCAACAGTGGATTATGTGTTCACATTCCACAGCTGG

TTCCAAGCACATTCCTGTTACACTGTTCCAAATCGTTCCTGTTGGCAAGACACAACCTGTTACATTAAGCGCACTTGAGACATCTGAGAAGATTTATGAA

TCATTTGACAGATGTTCACAACATCTCTTAAGAAATCAAATCCTATCGCCTTAGGAGCCAGAGAAAATAAACATGAGGCCGTGGGCATGAGCTAATGTTA

CATGTCCACACTGCTAGTCAGGTGGAAGAAGGGCTGGTCCAGAAGAGCAGGCAGGACCTTCCACTCACCGAGCTGTCAACAGGATGAGTCCGGGAACTGG

GCACCAGCTTTGGAAAGGACTCCAGAAAAGCCTACGCTGAACCCAAACAAGAAGCTAAAGCAGCATACTGAACAGTGGTGGGAGCGTCTTTCCTGAGCTT

CCTGCTTAGTGTTGGAACAGGCATCACGGGTCTCCCCAGCAGCTGCCTTTGCTGTTGGTAGTGGGGGCTGTGGACCCACAATCAATCATTCCTTCAGAAT

TCCCTGGGCTTTTCAGTGGTGTTGGGTTATGTTATGGTTAGCATTGGTGTTGTAGATGATGGTAGTTTATGTCATAGTTACCGTGGTTGGCGCTGGTGTT

ATGGTGTTAGCACCAGGTCCTCTGTGTCACTGTCTCGGGACTTCATAATTCTGAGCATAGCTATAACACTGGTGTCAGGCCTGGCAGAGATCCACGCTGC

ACGGCCTGTGGGGACCATGCTGGGGACGAGGAGGCAGTGAGTCTGTTTGGTGAGTGTGCTGCCTCCATGGAGCACAAAGGTTTTCAAGTCTCACCCCCAC

AGCCTTGGGGCTTTAGAGGAAGTAGACACTGTCTGCCTGCCAGAGTTGTAGACGCAACCCTTCCGTCATTTGAACACTGGTTTCCCCGCCGACCACATCT

ACCTCTCTGTGCGTGACTGCGACAAAGTTCAACTGAAGATGCTATGGTAACTTTTTCTCTTTTGCTTTAAAACTGTCTTTTGTTTTCAAACAAAACTGAT

TTATATCATGAGTTTTGGGAGCTTTAGTAACATGTCTGTGGCTACTTCTCCTTTTACACAAATATGATAGCATATTTTTCATGGTAAGGAAAAAAATAAA

ATCAAAATTTGCTTTAATTTATGCTCATTAGGATTGAACTGTCAGCTTAAAATACTTTCTATGTTTCTGCACTGCCAATGTCTGTTTTATGTATTTGTTT

GTCCAAATGTACCTATAAAAAGAATACATTAGACAGTTATGTTTACTCATTCCAACCTGGAATTGGTTTTAAACGGCTGGAACTTTAAGGAACGGCACTG

CAGTCTTTACGCATGTTACAAACGTTAAGGTTCTGTGGATTTTTTAAATTCTTCCCTATTCTGTTTTAAACTGGCACACCTCTGGTTGACGCTCAGTGTT

TATGCTAAAAACCAAATTTTTTCAAAGAGATGGCTAAGTAATTAAGTGGGTTATTTATAATGAATGGAAAATTTAAAAAAAAAATTCTATGATTAAACAG

AGAGTACTTGACG
Translation
MRLLERARKEWFMVGIVVAIGAAKLEPSVGVNGG - UNI11100 - - UNI27250 - GPLKPEITVSYIAVATIFFNSGLSLKTE - UNI20548

 - ELTSALVHLRLHLFIQIFTLAFFPAAIWLFLQLLSVTSINEWLLKG GLQTVGCMPPPVSSAVILTKAVGGNE - UNI17363 - - UNI30536

 - AAAIFNSAFGSFL - UNI1779 - - UNI17363 - - UNI31932 - GIVVTPVLLLLF - UNI1779 - - UNI17183 - - UNI20

474 - - UNI31097 - IVRRYIKDWLERKKPPFGVVSSSVLLMIIYTTFCDTFSNPNIDLDKFSLILILFII IVSVQLSFMLLTFIFSTR RNNSG

FTPADTVAIIFCSTHKSLTLG - UNI16508 - GIPMLKIVFAGHEHLSLISVPLLIYHPAQILLGSVLVPTIKSWMVSRQK - UNI9859 - - U

NI16508 - GVKLTRPTV
Transcript ENSMUST00000093415
Sequence
CTGTCACTGGGTACTACTACTCCCAGCCCGCCTCGGAGCCGCCCGAGCCACCCCTCGGTCTTTAGTTTACGAGTGGCAATTTGACTTGCTCTGCTGCATG

TCTGGAGGGATCGAGGAAAGTGTGGAGACGCCCCGGGGATTTAGGGATCGCAGTTTGGAAAGCAAGCCAGCCAAACAAATAAACAAAACCCACCCGCCCT

AACAAATATGAGGCTGCTGGAGAGGGCGAGGAAAGAATGGTTCATGGTCGGGATAGTGGTGGCGATCGGCGCCGCTAAGCTCGAGCCGTCGGTCGGAGTG

AACGGGG - UNI11100 - - UNI27250 - GACCACTGAAGCCAGAGATAACTGTGTCCTACATTGCCGTCGCAACGATATTCTTCAACAGTGGAC

TGTCATTAAAAACGGAG - UNI20548 - GAGCTGACCAGCGCACTGGTGCACCTGAGACTGCATCTTTTCATCCAAATCTTCACACTTGCCTTCTTC

CCAGCAGCAATATGGCTCTTTCTTCAGCTCTTATCAGTCACATCCATCAACGAGTGGCTTTTAAAAGG TCTGCAGACAGTAGGTTGCATGCCACCCCCT

GTGTCTTCTGCCGTGATTTTAACCAAGGCAGTTGGTGGAAATGAG - UNI17363 - - UNI30536 - GCAGCTGCGATATTTAATTCAGCATTTG

GAAGTTTTTTG - UNI1779 - - UNI17363 - - UNI31932 - GGCATTGTTGTGACTCCGGTGCTCCTGCTGCTTTTC - UNI1779 - -

 UNI17183 - - UNI31097 - CTCGGTTCATCCTCTTCGGTGCCTTTTACATCCATTTTCTCTCAGCTGTTTATGACGGTGGTGGTTCCTCTTGTC

ATTGGACAG - UNI17183 - - UNI20474 - ATCGTCCGACGCTACATCAAGGACTGGCTGGAGAGGAAGAAGCCACCATTTGGTGTGGTCAGCA

GTAGCGTGCTACTCATGATCATCTACACCACCTTCTGTGACACCTTCTCCAACCCAAACATCGACCTGGACAAGTTCAGCCTCATCCTCATACTGTTCAT

AA - UNI16508 - GAATCCCAATGCTGAAGATAGTGTTTGCAGGCCATGAGCATCTCTCGCTGATATCCGTGCCCTTGCTCATCTACCACCCAGCTC

AGATTCTCCTGGGAAGTGTGTTAGTGCCAACAATAAAGTCTTGGATGGTGTCCAGGCAGAAG - UNI9859 - - UNI16508 - GGAGTGAAGCTG

ACAAGGCCGACAGTGTGACTCGGGTGGCGCCAGCCTTCCTGGAGTGTGTACATATATGTACAGGCTGTACATACAGGGGTTCTGAGGACCTGTCCTTGGG

GATGCTGCTTTGATGCCTATTTTATTTTTTTACAGAAAAAAATATGATATACCTGTTTAAGTGCCTTACGATGTTTTTGACAAGAGCGTTATTTCCAAAA

CACACTCTGTTGGCTACTGCCAAGGGTAGTACAGTATTTTGGACTCATTTTTTTCCCTAAGGCAGAAAAAAAAGTTCTAGTAAGGGACAAAAGCTAACAC

GTTTTCTTCGTACTGCCTTTGTGCAGGCAAGACTCTAATAGCACTATAACGTTCAAAATGAGGTCATGCCATCCAGAAACCTCCCTCCTGGTGACAGTGA

ACGATTCCAAAGTCTCATTCACCGCACACTTTGATTCACCGAGTGGTTCTTTGTTTCTAAGACTGTGACGGGCTCTTCCTTATCAACTCAGCGGGGGATG

CAGATCGCAGAGATGCCGAGAAGCGTCAGGTACCTCATTCCTTGACACCGTCTTCTTCCATCCATCCCCGCACACTCCAGAAACACTTCAGTCCCAGCAC

AGAGTGTGTGTGGGGGCTGGGGGGGGGGGGGGGAGTGCAGCTTAGATGTATTATCGGCTGCTTCAGAGAAAGTCCTGGTGAGTGTTGCCGTGAACTCGGA

CAGTGCTTTGGGACGTCTGCAATCGTACCTCAGTATGCTTCTCCCTTCCATCATTCCTTAGTTTCCCATTTTACTTACACACAACATCCCCGTGCAACAC

CCAAATGTCACAGTCAGCTGGAGAGTCACAGAAATCAACAGTGGATTATGTGTTCACATTCCACAGCTGGTTCCAAGCACATTCCTGTTACACTGTTCCA

AATCGTTCCTGTTGGCAAGACACAACCTGTTACATTAAGCGCACTTGAGACATCTGAGAAGATTTATGAATCATTTGACAGATGTTCACAACATCTCTTA

AGAAATCAAATCCTATCGCCTTAGGAGCCAGAGAAAATAAACATGAGGCCGTGGGCATGAGCTAATGTTACATGTCCACACTGCTAGTCAGGTGGAAGAA

GGGCTGGTCCAGAAGAGCAGGCAGGACCTTCCACTCACCGAGCTGTCAACAGGATGAGTCCGGGAACTGGGCACCAGCTTTGGAAAGGACTCCAGAAAAG

CCTACGCTGAACCCAAACAAGAAGCTAAAGCAGCATACTGAACAGTGGTGGGAGCGTCTTTCCTGAGCTTCCTGCTTAGTGTTGGAACAGGCATCACGGG

TCTCCCCAGCAGCTGCCTTTGCTGTTGGTAGTGGGGGCTGTGGACCCACAATCAATCATTCCTTCAGAATTCCCTGGGCTTTTCAGTGGTGTTGGGTTAT

GTTATGGTTAGCATTGGTGTTGTAGATGATGGTAGTTTATGTCATAGTTACCGTGGTTGGCGCTGGTGTTATGGTGTTAGCACCAGGTCCTCTGTGTCAC

TGTCTCGGGACTTCATAATTCTGAGCATAGCTATAACACTGGTGTCAGGCCTGGCAGAGATCCACGCTGCACGGCCTGTGGGGACCATGCTGGGGACGAG

GAGGCAGTGAGTCTGTTTGGTGAGTGTGCTGCCTCCATGGAGCACAAAGGTTTTCAAGTCTCACCCCCACAGCCTTGGGGCTTTAGAGGAAGTAGACACT

GTCTGCCTGCCAGAGTTGTAGACGCAACCCTTCCGTCATTTGAACACTGGTTTCCCCGCCGACCACATCTACCTCTCTGTGCGTGACTGCGACAAAGTTC

AACTGAAGATGCTATGGTAACTTTTTCTCTTTTGCTTTAAAACTGTCTTTTGTTTTCAAACAAAACTGATTTATATCATGAGTTTTGGGAGCTTTAGTAA

CATGTCTGTGGCTACTTCTCCTTTTACACAAATATGATAGCATATTTTTCATGGTAAGGAAAAAAATAAAATCAAAATTTGCTTTAATTTATGCTCATTA

GGATTGAACTGTCAGCTTAAAATACTTTCTATGTTTCTGCACTGCCAATGTCTGTTTTATGTATTTGTTTGTCCAAATGTACCTATAAAAAGAATACATT

AGACAGTTATGTTTACTCATTCCAACCTGGAATTGGTTTTAAACGGCTGGAACTTTAAGGAACGGCACTGCAGTCTTTACGCATGTTACAAACGTTAAGG

TTCTGTGGATTTTTTAAATTCTTCCCTATTCTGTTTTAAACTGGCACACCTCTGGTTGACGCTCAGTGTTTATGCTAAAAACCAAATTTTTTCAAAGAGA

TGGCTAAGTAATTAAGTGGGTTATTTATAATGAATGGAAAATTTAAAAAAAAAATTCTATGATTAAACAGAGAGTACTTGACG
Translation
MRLLERARKEWFMVGIVVAIGAAKLEPSVGVNGG - UNI11100 - - UNI27250 - GPLKPEITVSYIAVATIFFNSGLSLKTE - UNI20548

 - ELTSALVHLRLHLFIQIFTLAFFPAAIWLFLQLLSVTSINEWLLKG GLQTVGCMPPPVSSAVILTKAVGGNE - UNI17363 - - UNI30536

 - AAAIFNSAFGSFL - UNI1779 - - UNI17363 - - UNI31932 - GIVVTPVLLLLF - UNI1779 - - UNI17183 - - UNI31

097 - LGSSSSVPFTSIFSQLFMTVVVPLVIGQ - UNI17183 - - UNI20474 - IVRRYIKDWLERKKPPFGVVSSSVLLMIIYTTFCDTFSN

PNIDLDKFSLILILFIR - UNI16508 - RIPMLKIVFAGHEHLSLISVPLLIYHPAQILLGSVLVPTIKSWMVSRQK - UNI9859 - - UNI16

508 - GVKLTRPTV

For any suggestions or comments, please send an email to unitrap@crg.es