Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031691 (Tnpo2)
Chromosomal location
Chr 8: 87560814 - 87581479 (+)
Description
transportin 2 (importin 3, karyopherin beta 2b) Gene [Source:MGI Symbol;Acc:MGI:2384849]
RefSeq_dna
NM_145390 
RefSeq_peptide
NP_663365.3 NP_001116315.1 
UniGene
Mm.471720 
MGI
MGI:2384849 
Uniprot/SWISSPROT
Q99LG2 
Uniprot/SPTREMBL
Q3U1S0 Q3U316 
Human Ortholog
ENSG00000105576 (TNPO2)
Omim not available
UniTrap UNI3664
Vector Insertion
Chr 8: 87560877 - 87562233
Public Clones AT0055 (sanger) (sanger) CA0237 (sanger) Ex331 (baygenomics) P117G09 (ggtc)
D187D10 (ggtc) D119C07 (ggtc) IST15058E7 (tigm)
Private Clones OST436876 (lexicon) OST42543 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30287
Vector Insertion
Chr 8: 87562389 - 87564360
Public Clones D041E02 (ggtc) IST14578F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2945
Vector Insertion
Chr 8: 87569216 - 87571019
Public Clones AD0090 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2390
Vector Insertion
Chr 8: 87571081 - 87571188
Public Clones AD0082 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5542
Vector Insertion
Chr 8: 87571355 - 87571481
Public Clones YTA123 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10029
Vector Insertion
Chr 8: 87571635 - 87573834
Public Clones XE039 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8498
Vector Insertion
Chr 8: 87574430 - 87575436
Public Clones RRK459 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1341
Vector Insertion
Chr 8: 87577446 - 87577654
Public Clones DB0050 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6749
Vector Insertion
Chr 8: 87577754 - 87578224
Public Clones HMA058 (baygenomics) A056B05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4
Vector Insertion
Chr 8: 87578321 - 87578590
Public Clones GC0194 (tigem) GC0241 (tigem) CSI129 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7544
Vector Insertion
Chr 8: 87579153 - 87579238
Public Clones XL027 (baygenomics) RRR188 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093360
Sequence
CTTCCGCGCGAGCCTCTGGAGAAGCTGCAGCACTTAGGCGCCGCCGCTGCCTCCCGGGGCCTG - UNI3664 - AACTCCAGCGACCCAGCGCTGATC

CAGGCTCCTACCCCTGCAGTTCGCCTTGCGCCATGGACTGGCAGCCAGACGAGCAGGGCCTGCAGCAGGTCTTGCAGCTTCTCAAAGACTCGCAGTCGCC

CAACACAGCTACTCAGCGCATTGTGCAGGAT - UNI30287 - AAACTTAAACAACTCAACCAGTTTCCTGACTTTAACAACTACCTGATCTTTGTCC

TGACCAGACTCAAATCAGAAG ATGAGCCAACCCGCTCTCTGAGTGGCCTCATCCTCAAGAACAATGTGAAGGCGCATTACCAGAGCTTCCCGCCTCCTG

TGGCTGACTTCATCAAACAGGAGTGTCTCAACAACATTGGCGATGCCTCCTCTCTCATCAGAGCCACCATCG GCATTCTCATCACCACCATCGCTTCCA

AGGGTGAGCTGCAGATGTGGCCAGAGCTGCTGCCTCAGCTGTGCAACCTGCTCAACTCAGAGGATTATAATACCTGTGAG GGAGCCTTTGGAGCCCTAC

AGAAGATCTGTGAAGACTCCTCGGAGCTTTTGGATAGTGATGCTCTCAACAGGCCCCTCAACATCATGATCCCTAAATTCCTGCAGTTTTTCAAGCACTG

CAGCCCTAAGATCCG GTCCCACGCCATCGCCTGTGTGAACCAGTTCATCATGGACCGGGCCCAAGCGCTGATGGACAACATTGACACTTTCATTGAG C

ACCTGTTTGCCTTGGCTGTGGATGATGACCCTGAGGTGAGAAAGAACGTGTGCCGGGCCCTTGTGATGCTTTTGGAAGTGCGAATTGACAGGCTCATCCC

TCACATGCACAGCATCATCCAG TACATGCTGCAGAGGACCCAGGACCATGATGAGAACGTGGCCCTGGAGGCCTGTGAGTTCTGGCTGACGCTAGCCGA

GCAGCCCATCTGCAAGGAAGTCCTGGCCTCTCATCTGGTCCA - UNI2945 - GTTGATCCCTATCCTCGTGAATGGGATGAAGTACTCTGAAATTGA

CATCATCCTTCTTAAG - UNI2390 - GGGGATGTGGAGGAGGACGAGGCGGTACCTGACAGTGAGCAGGACATCAAGCCCCGGTTCCACAAGTCACG

CACAGTGACATTGACTCACGAGGCTGAGCGGCCTGATAGCTCTGAGGATGCTGAGGACGACGATGATGACGACGCTTTGTCGGACTGGAATCTGA - UN

I5542 - GGAAGTGCTCTGCAGCTGCGCTGGATGTCCTTGCCAATGTCTTCCGGGAGGAACTGTTGCCCCACCTACTTCCCCTGCTCAAGGGCCTCCTA

TTCCACCCTGAGTGGGTGGTCAAAGAGTCAGGGATCCTGGTGCTGGGCGCCATCGCTGAGG - UNI10029 - GCTGCATGCAGGGAATGGTGCCCTA

TCTACCTGAGCTGATCCCACACCTCATCCAGTGCCTGTCAGATAAGAAGGCTCTAGTACGCTCCATTGCCTGCTGGACGCTGAGCCGCTATGCCCACTGG

GTAGTCAGCCAGCCACCTGACATGCACCTCAAGCCTCTGATGACGGAGCTGCTCAAGCGTATCTTGGATGGCAATAAGCGGGTTCAGGAGGCAGCCTGCA

G TGCATTTGCTACCCTGGAGGAGGAGGCATGCACGGAGCTGGTGCCCTACCTCAGCTATATCCTTGACACTCTCGTTTTTGCCTTTGGCAAATACCAGC

ATAAGAACCTGCTCATCCTCTATGATGCCATTGGCACCCTGGCCGACTCTGTGGGCCACCACCTCAATCAGCCG - UNI8498 - GAGTACATTCAGA

AGCTGATGCCTCCGCTGATCCAGAAGTGGAATGAGCTCAAGGACGAAGACAAGGACCTCTTCCCCCTGCTGGAG TGCCTATCATCTGTGGCCACTGCCC

TGCAGAGTGGCTTCCTGCCCTACTGCGAGCCTGTCTACCAGCGCTGTGTTACCCTGGTACAGAAGACACTGGCCCAGGCCATG ATGTATACACAACACC

CCGAACAATATGAGGCCCCAGACAAAGACTTCATGATTGTTGCGTTGGACCTGCTTAGTGGCTTGGCTGAGGGCCTGGGTGGCCACGTGGAGCAGCTGGT

AGCTCGGAGTAACATCATGACATTGCTCTTCCAGTGTATGCAG GATTCCATGCCTGAGGTCCGGCAGAGCTCCTTTGCCCTTCTGGGAGACCTTACCAA

AGCCTGCTTTATCCACGTCAAGCCCTGTATCG - UNI1341 - CTGAGTTCATGCCTATTCTGGGTACCAACCTGAACCCTGAGTTCATCTCTGTCTG

CAACAATGCTACCTGGGCCATTGGGGAGATCTGCATGCAGATGG - UNI6749 - GGGCAGAGATGCAGCCTTATGTGCAGATGGTCCTCAACAACCT

GGTGGAGATCATTAACAGGCCCAACACACCCAAGACGCTGCTGGAAAACACAG - UNI4 - GTCGCCTGACGAGTCCCTCTGCCATTCCAGCCATCAC

CATCGGCCGCCTGGGCTACGTGTGCCCGCAGGAGGTGGCACCCATGCTGCAGCAGTTCATCCGGCCTTG GTGCACGTCCCTTAGGAACATCCGGGACAA

CGAGGAGAAGGATTCTGCCTTCCGAGGCATCTGCATGATGATTGGTGTCAATCCTGGGGGTGTTGTGCAG GACTTTATTTTCTTCTGCGATGCTGTAGC

CTCCTGGGTGAGCCCGAAGGATGACCTTCGGGACATGTTTTATAAG - UNI7544 - ATCCTCCATGGCTTCAAAGACCAAGTTGGGGAGGAGAACTG

GCAACAGTTCTCAGAGCAGTTCCCACCTCTGCTCAAGGAGAGGCTGGCAGCCTTCTATGGGGTCTAGGTGAACGTGGAGACCACCAG GTTTTTGTCTGC

GTCATCGTCGGAGGGTGTGCTGGGAATGTGCTGCTTCCAGAAGTCACTGTGCCCTGGTCGAGGGGGGTTAGGGAGGAGTCAGTGGGACCTAAATCCAGGT

GCAACGCAGTCTGTGCATCTGTCCATCTGTCGGTCCACTTGCCCCACCGGGCCTGATGAGTGGGCAGGTGGGTGGGGACTCCATTCTCATCCTACAAATA

GGGAGGGGGGTGGGACTTCTTGGTGGGCAAGAGTTCTCTGGGCTCTAATCTGGGTCATCTCGGGCAGCCCACTTGGGCCAGCTATGTGGGAGGGAGGAAT

CCATAAGGCCTACCGAATCCGGTGTCAGATAAGGCAAGGGAATTACAGGTGGGGAGGGGGGTTCCTTGTAGAGAAGCATACACTCACATGTACACATGTG

GACACACGCATGTGCGGGCACCACAGCCAGCTAGGCTGGGCCAAACGCCCCACCATTTCCTCGACTGCATGGAGACAGTAGAATTAGTGAACCCCCAAAT

TATGCCTATGGCCTCTGTGTACCTTGCATCTAGAGTATAAGAAGCTTCTGCTGTTCTGCCAAAATTGGCGGGAATTGGGGGGGCTGGGAGGTTTGGGGGA

CCTCAGCTGGGCTCCCGGGGCCAAGGGAGGAGGGTGGTCATTTTGGGGCTGCCATCTCAGCACTGGCTCACTTGGACCTGCTCCATACACTTCCTGCCAG

CTTCATGGCAGCCTCATGTAGTGTGTCCCCATCGTTGTCACATCCTAGCCAGCAGCAGAGTGGGGATCATTGGAGCAGCTGAGACTGGCTTGAGGCTACC

CTGTTCCTGTGCTCCAAAGGTAATTAAAGGCACAGGCCTGGGACTAGTTTTCCTTGAGAAAGCTAATAATGGTTGCCAGAGCTGCTTTCCTGGATCTCTT

GAAACAGCTTTAAGGATAGTTCAGTTCTCTGCACCTGAGAACCCCATTCTCAAGAGCTGGGGTAACAGCATGTGATGGTGAGAACAAAGGACGAAGTTTA

CTGGGTCCAGCAAGATTTGAAAGCTTGGAGGAGCAGGGTGTACCCAGGGCCTCAAACTTTGTCCCTTTTGGGACTTACGTTTATCACAGTGTCCGCTGGA

CTCAGACCACGCCAGATTGGTACACTGACTCAAAACCTTTGAAGAAATTTGTTGGCGATGCCATCGGGGTGGGAGGGGCTTCCCGAGAGGAGAGGGGCAT

GATTATTTCCAGATTAGCTGTGGAAATGAGTCTTGTAAGGTCCCTGAGGTTTATCCTCCATCCCTTTCTTTGCTTCCTACATATTTGGGAGCCCATTATA

TCTTGGGCTTTGACTGGAGTTCTGCATTTTAGGGCCTGCTCCATCATCCCTCCAAGGACTTGGACCTTTATCCTTTCCAGGCCTTGTGTCCTTTCTTAAG

TAGGGTCAGGCCCTGCCTCTGTTCCCAGGGACACTTAGTGCACATTCCATAACTCAGCTACTGGTCCCCATCCCCTCCAGCCTGAAACTTGAGCAGGTCT

CTGGAAGCCATTTGTAGGAAAAAAAAATTTTTTTTAAAGAAAAATACCATTAGCTTTCTGGTAATTCCACTTCTTAGGAGCATCCTCTGCTGGGTCTTGG

GGTGTATTGATGGATTGACTATCTGATGTAGTTGTGGCCCCTCTTTGTCCAATGGGGAGGGGGAGGGAGTTCCAACTACCTTCAGGAAACGGGAGCCTGA

TTCTTGTATTTCCCTTTTTTTATTTTATTTTATTTTATTATTTTTTTAAAAGAAATTATTTAATTTTTTAATTTATTTTTTAGTTGGTTTTTGCACAATG

AAGTTTGAGTTTCTTAACCTCCCTTGTCCGGGGCTGCTGACATGGACTGACCTTGATCTGTAGCCCTCCCTGCTGCCATTCCCCTGAGTCTTTATTACCA

TCACCCCTGGGCTCCCAGGTCTATCCATCTGTTACTGTGCTGTGCTGGGGACTAGCGCCTAGGTGGCGTGAGATTCCACTCGTGTAGAACTTTGTTGAGT

AAAGGTCAGTTTCTTGTG
Translation
 - UNI3664 - MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQD - UNI30287 - KLKQLNQFPDFNNYLIFVLTRLKSED DEPTRSLSGLILK

NNVKAHYQSFPPPVADFIKQECLNNIGDASSLIRATIG GILITTIASKGELQMWPELLPQLCNLLNSEDYNTCE GAFGALQKICEDSSELLDSDALNR

PLNIMIPKFLQFFKHCSPKIR RSHAIACVNQFIMDRAQALMDNIDTFIE HLFALAVDDDPEVRKNVCRALVMLLEVRIDRLIPHMHSIIQ YMLQRTQ

DHDENVALEACEFWLTLAEQPICKEVLASHLVQ - UNI2945 - QLIPILVNGMKYSEIDIILLK - UNI2390 - GDVEEDEAVPDSEQDIKPRF

HKSRTVTLTHEAERPDSSEDAEDDDDDDALSDWNLR - UNI5542 - RKCSAAALDVLANVFREELLPHLLPLLKGLLFHPEWVVKESGILVLGAIAE

G - UNI10029 - GCMQGMVPYLPELIPHLIQCLSDKKALVRSIACWTLSRYAHWVVSQPPDMHLKPLMTELLKRILDGNKRVQEAACS SAFATLEE

EACTELVPYLSYILDTLVFAFGKYQHKNLLILYDAIGTLADSVGHHLNQP - UNI8498 - EYIQKLMPPLIQKWNELKDEDKDLFPLLE CLSSVAT

ALQSGFLPYCEPVYQRCVTLVQKTLAQAM MYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVARSNIMTLLFQCMQ DSMPEVRQSSFALLGD

LTKACFIHVKPCIA - UNI1341 - AEFMPILGTNLNPEFISVCNNATWAIGEICMQMG - UNI6749 - GAEMQPYVQMVLNNLVEIINRPNTPK

TLLENTG - UNI4 - GRLTSPSAIPAITIGRLGYVCPQEVAPMLQQFIRPW WCTSLRNIRDNEEKDSAFRGICMMIGVNPGGVVQ DFIFFCDAVAS

WVSPKDDLRDMFYK - UNI7544 - ILHGFKDQVGEENWQQFSEQFPPLLKERLAAFYGV 

For any suggestions or comments, please send an email to unitrap@crg.es