Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031701 (Dnaja2)
Chromosomal location
Chr 8: 88062531 - 88079237 (-)
Description
DnaJ (Hsp40) homolog, subfamily A, member 2 Gene [Source:MGI Symbol;Acc:MGI:1931882]
RefSeq_dna
NM_019794 
RefSeq_peptide
NP_062768.1 
UniGene
Mm.475895 
MGI
MGI:1931882 
Uniprot/SWISSPROT
Q9QYJ0 
Uniprot/SPTREMBL
Q3TFF0 
Human Ortholog
ENSG00000069345 (DNAJA2)
Omim not available
UniTrap UNI25093
Vector Insertion
Chr 8: 88077310 - 88077815
Public Clones not available
Private Clones OST195407 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11973
Vector Insertion
Chr 8: 88072862 - 88077085
Public Clones P012G02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29505
Vector Insertion
Chr 8: 88070411 - 88072597
Public Clones P127G03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2396
Vector Insertion
Chr 8: 88064352 - 88070411
Public Clones AD0051 (sanger) AD0583 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034138
Sequence
GTCTCCTCGGCCTGCGCCGCCGCCGCTCGTGGTCCGGGTCGCGCTCCTTCCGCTCCGCCGCCTGCTTGCGAGTGCTGCCCGGCAGGCCGCCATGGCGAAC

GTGGCCGACACGAAGCTGTACGACATCCTGGGCGTCCCTCCCGGCGCTAGCGAGAACGAGCTGAAGAAG GCATACCGAAAGTTAGCCAAAGAATACCAC

CCTGATAAGAATCCAAATGCTGGAGACAAA - UNI25093 - TTTAAAGAAATAAGTTTTGCATATGAAGTATTGTCAAATCCAGAGAAGCGAGAGCT

GTATGACAGATATGGAGAACAAGGCCTACGGGAAGGCAGCGGCGGAGGCGGTGGCATGGATGATATCTTCTCACATATTTTTGGTGGAGGATTGTTTGGC

TTTATGGGCAATCAGAGTAGAAGTCGAAATGGCAGAAGAAGAGGCGAGGACATGATGCATCCACTAAA - UNI11973 - AGTATCTTTAGAAGACCT

GTACAATGGCAAGACAACCAAACTACAACTTAGCAAGAATGTGCTCTGTAGTGCATGCAGTGG - UNI29505 - CCAAGGTGGGAAGTCTGGAGCTG

TTCAGAAATGCAGCGCTTGTCGGGGTCGAGGTGTGCGCATTATGATCAGACAGCTGGCTCCAGGAATGGTGCAGCAGATGCAGTCCGTGTGCTCCGACTG

TAATGGAGAAG - UNI29505 - GGGAGGTCATCAATGAAAAAGACCGCTGTAAAAAATGTGAAGGGAAGAAGGTAATCAAAGAAGTCAAGATTCTGG

AAGTCCATGTAGACAAAGGCATGAAACATGGACAGAGGATTACGTTCACTGGGGAAGCAGACCAGGCTCCAGGAGTGGAACCTGGAGATATTGTTCTTTT

GCTACAGGAAAAAGAACATGAG - UNI2396 - - UNI29505 - GTGTTCCAGAGAGATGGGAATGATTTGCATATGACATATAAGATAGGACTTG

TTGAAGCTTTATGTGGATTTCAGTTCACATTTAAACATCTTGATGCTCGTCAGATTGTGGTGAAATACCCCCCTGGCAAAGTAATTGAACCAG GATGTG

TTCGTGTTGTTCGAGGTGAAGGAATGCCACAGTATCGTAATCCCTTTGAAAAGGGTGATCTCTACATAAAGTTTGATGTACAGTTTCCTGAGAATAACTG

GATCAACCCAGACAAACTTTCT GAATTAGAAGATCTCCTGCCATCTAGACCAGAAGTTCCTAATGTTATTGGAGAGACAGAAGAAGTGGAGCTTCAGGA

ATTTGATAGCACTCGAGGCTCTGGCGGTGGTCAGAGACGTGAAGCCTATAATGATAGCTCTGATGAAGAAAGTAGCAGCCATCATGGACCTGGAGTGCAG

TGTGCCCATCAGTAAACTGCAGGCCACTGCACAGGTGGGTTTTCTTTCCACATTTGCCGGATTTGCCAGCTGCTGGAGTACCTGATAAGTCCAGATGGAC

TGATGGACATCTGTTGATCTATGTGTAACTTCTAAAATTGGTATCGTATCCACAGAGTGTATAATTTAAACTAACCACAGAGCTTTACATCTTCATTTCG

ACTGTTCTGTAGCAGAGTAAAGCACTTGAAATAAGACTCCCTTTCACATGTGGGTTATAAGTTTCAGTCCTGGTATCTGCTTGATTTTTATCAGTTTTGT

GTAGACTTTATGTTTCATATTTTAAACTCAAATCCAGCATTGTAAAGTTTGTACAATTTGTCCTGAAGCTTTGTGTTTGGCTGCACCTGCATAAGCTGCT

ACAAATAGAATAAAGAATTCATAGCCTGTATCTATCATTTAGATGCATGGAAAAATGGGCTTTGCACACAATGGGTTTGAAGCTGACTGGGAACAATGGA

AAAAAATTACATTAGCCATGGTTGTAAAGTTTTTTGGCTTTTTTTTAAAACCATTTTGTGAAAGGTTTCTGAAACTTGATAATAAAAAGCAGTTGGTGT
Translation
MANVADTKLYDILGVPPGASENELKK AYRKLAKEYHPDKNPNAGDK - UNI25093 - FKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMD

DIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLK - UNI11973 - KVSLEDLYNGKTTKLQLSKNVLCSACSG - UNI29505 - GQGGKSGA

VQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEG - UNI29505 - GEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQA

PGVEPGDIVLLLQEKEHE - UNI2396 - - UNI29505 - VFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPG GCVRVV

RGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLS ELEDLLPSRPEVPNVIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAH

Q

For any suggestions or comments, please send an email to unitrap@crg.es