Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031711 (Zfp330)
Chromosomal location
Chr 8: 85287520 - 85298059 (-)
Description
zinc finger protein 330 Gene [Source:MGI Symbol;Acc:MGI:1353574]
RefSeq_dna
NM_145600 
RefSeq_peptide
NP_663575.1 
MGI
MGI:1353574 
Uniprot/SWISSPROT
Q922H9 
Human Ortholog
ENSG00000109445 (ZNF330)
Omim not available
UniTrap UNI22256
Vector Insertion
Chr 8: 85296911 - 85297955
Public Clones not available
Private Clones OST302187 (lexicon) OST208358 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21730
Vector Insertion
Chr 8: 85293299 - 85294699
Public Clones not available
Private Clones OST319534 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27521
Vector Insertion
Chr 8: 85290673 - 85291111
Public Clones not available
Private Clones OST57637 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034147
Sequence
CTGACATAGCAGGATATCCGGTCTCGCTCCCACCGTTGGAAACGGGCTGCTTCTGCCGTTCTAGCCCGCGGCTCGCCCTCTCCTCCGCGTCCTCGGCCAC

TGCG - UNI22256 - AAAGAAGGGAACATGCCGAAGAAAAAGACCGGTGCGAGGAAGAAGGCAGAGAACCGCCGAGAACGCGAGAAACAACTGCGAG

CATCAAGAAGTACTGTCGACCTAGCCAAACACCCATGCAATGCTTCAATG GAATGCGACAAATGTCAGAG GCGGCAGAAGAATAGAGCATTTTGCTAT

TTTTGTAATTCTGTTCAGAAGTTACCAATTTGTGCACAGTGTG - UNI21730 - GGAAAACAAAGTGTATGATGAAGTCGTCAGACTGTGTTATCAA

GCATGCTGGTGTGTACAGTACTGGCCTTGCTATGGTG GGTGCAATATGTGACTTCTGCGAAGCTTGGGTTTGCCATGGGAGGAAGTGTCTTAGCACCCA

TGCCTGTGCCTGCCCACTCACAGATGCAGAGTGTGTGGAATGTGAGCGAGGGGTATGGGACCATG - UNI27521 - GAGGAAGAATATTCAGCTGTT

CGTTTTGCCATAATTTTCTCTGTGAAGATGACCAGTTTGAGCATCAAGCCAGCTGCCAAGTTTTAGAAGCAGAAACATTTAAAT GTGTTTCCTGCAATC

GACTTGGCCAGCATTCATGTCTCCGCTGTAAG GCTTGTTTCTGTGATGAACATACAAGGAGCAAAGTGTTTAAGCAAGAAAAAGGAAAACAACCTCCTT

GCCCTAAATGTGGGCATGAAACACAGGAGACAAAGGATCTTAGCATGTCAA CACGCTCCTTGAAATTTGGCAGGCAGACTGGAGGAGAAGAAGATGGAG

CCTCAGGGTATGATGCTTACTGGAAGAACCTGTCGTCGGACAAGTATGGAGATACTGGATACCATGATGATGATGAGGAGGAGGATGAAGCAGAGGATGA

AGAGGAAGAAGATGGGAAGGACTCAGATGCTGAGTCATCAGATCTGTTCAATAACTTGAATTTAGGAAGGACCTATGCCAGTGGCTACGCTCACTACGAG

GAGCAGGAGAGCTAGGAGCTGCCCCTTGTTGGCACTTGTGGGAAGAGCAGGCTGAATCTGAGGATGCTCAGATGGACCCTCCCTTGCCTTGTCCAAAAGT

CCAGTCACACTGGGCTCGGGAGGTTCTCGCAGTTTCTAGGGATGCTATGTGAACTTGCAGTGTACGTAAAGTGAGTTAGATGTAAGACAGATGGAGCATC

ATGGGTTGGATTATTACTGAGTTCAATAATCTGGTGGGTTTTGCCAGCTAGAAACATAATAAAATACATGATAAAGGAATAGAAAGGAAATATATTTATT

TGAAATTAAATTACTGCTTATAAATTCATGTCTCTGATTTTACAAAGTGTAATGGGTAAAATTACCATATTCTTTTTCTTATTTCAATCCATACAATGAG

AGTCATGTTCAGTTTTTCACTGACTTCATGCTGGGTAATGTTCACTCTGCATTAGCGGTTGCCATGTTCACCGTTTTCTTACAATGTCTATCCAGTGCTT

GTTACTGTCTCACTGACAGACAGAAGTCTAGCTGTTTTCATCCACATAATGGCAGGCAGGGCTAGTGTTGCTGCTGCTTCACCCAGAGAATCTCATTTTA

CAATAAAGTTAGTATTATACTTG
Translation
 - UNI22256 - MPKKKTGARKKAENRREREKQLRASRSTVDLAKHPCNASM ECDKCQR RRQKNRAFCYFCNSVQKLPICAQCG - UNI21730 

- GKTKCMMKSSDCVIKHAGVYSTGLAMV GAICDFCEAWVCHGRKCLSTHACACPLTDAECVECERGVWDHG - UNI27521 - GGRIFSCSFCHNF

LCEDDQFEHQASCQVLEAETFKC CVSCNRLGQHSCLRCK ACFCDEHTRSKVFKQEKGKQPPCPKCGHETQETKDLSMST TRSLKFGRQTGGEEDGAS

GYDAYWKNLSSDKYGDTGYHDDDEEEDEAEDEEEEDGKDSDAESSDLFNNLNLGRTYASGYAHYEEQES
Transcript ENSMUST00000086864
Sequence
CTGACATAGCAGGATATCCGGTCTCGCTCCCACCGTTGGAAACGGGCTGCTTCTGCCGTTCTAGCCCGCGGCTCGCCCTCTCCTCCGCGTCCTCGGCCAC

TGCG - UNI22256 - AAAGAAGGGAACATGCCGAAGAAAAAGACCGGTGCGAGGAAGAAGGCAGAGAACCGCCGAGAACGCGAGAAACAACTGCGAG

CATCAAGAAGTACTGTCGACCTAGCCAAACACCCATGCAATGCTTCAATG GAATGCGACAAATGTCAGAG GCGGCAGAAGAATAGAGCATTTTGCTAT

TTTTGTAATTCTGTTCAGAAGTTACCAATTTGTGCACAGTGTG - UNI21730 - GGAAAACAAAGTGTATGATGAAGTCGTCAGACTGTGTTATCAA

GCATGCTGGTGTGTACAGTACTGGCCTTGCTATGGTG GGTGCAATATGTGACTTCTGCGAAGCTTGGGTTTGCCATGGGAGGAAGTGTCTTAGCACCCA

TGCCTGTGCCTGCCCACTCACAGATGCAGAGTGTGTGGAATGTGAGCGAGGGGTATGGGACCATG - UNI27521 - GAGGAAGAATATTCAGCTGTT

CGTTTTGCCATAATTTTCTCTGTGAAGATGACCAGTTTGAGCATCAAGCCAGCTGCCAAGTTTTAGAAGCAGAAACATTTAAAT GTGTTTCCTGCAATC

GACTTGGCCAGCATTCATGTCTCCGCTGTAAG GCTTGTTTCTGTGATGAACATACAAGGAGCAAAGTGTTTAAGCAAGAAAAAGGAAAACAACCTCCTT

GCCCTAAATGTGGGCATGAAACACAGGAGACAAAGGATCTTAGCATGTCAA CACGCTCCTTGAAATTTGGCAGGCAGACTGGAGGAGAAGAAGATGGAG

CCTCAGGGTATGATGCTTACTGGAAGAACCTGTCGTCGGACAAGTATGGAGATACTGGATACCATGATGATGATGAGGAGGAGGATGAAGCAGAGGATGA

AGAGGAAGAAGATGGGAAGGACTCAGATGCTGAGTCATCAGATCTGTTCAATAACTTGAATTTAGGAAGGACCTATGCCA TTTCTAGGGATGCTATGTG

A
Translation
 - UNI22256 - MPKKKTGARKKAENRREREKQLRASRSTVDLAKHPCNASM ECDKCQR RRQKNRAFCYFCNSVQKLPICAQCG - UNI21730 

- GKTKCMMKSSDCVIKHAGVYSTGLAMV GAICDFCEAWVCHGRKCLSTHACACPLTDAECVECERGVWDHG - UNI27521 - GGRIFSCSFCHNF

LCEDDQFEHQASCQVLEAETFKC CVSCNRLGQHSCLRCK ACFCDEHTRSKVFKQEKGKQPPCPKCGHETQETKDLSMST TRSLKFGRQTGGEEDGAS

GYDAYWKNLSSDKYGDTGYHDDDEEEDEAEDEEEEDGKDSDAESSDLFNNLNLGRTYAI ISRDAM

For any suggestions or comments, please send an email to unitrap@crg.es