Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031714 (Gab1)
Chromosomal location
Chr 8: 83288339 - 83404395 (-)
Description
growth factor receptor bound protein 2-associated protein 1 Gene [Source:MGI Symbol;Acc:MGI:108088]
RefSeq_dna
NM_021356 
RefSeq_peptide
NP_067331.2 
MGI
MGI:108088 
Uniprot/SWISSPROT
Q9QYY0 
Uniprot/SPTREMBL
Q505A4 
Human Ortholog
ENSG00000109458 (GAB1)
Omim not available
UniTrap UNI451
Vector Insertion
Chr 8: 83324295 - 83403430
Public Clones (sanger) DC0124 (sanger) YTC193 (baygenomics) D048E07 (ggtc) D026A02 (ggtc)
PST17147-NL (escells) PST12387-NR (escells) PST23656-NL (escells) PST1642-1 (escells)
IST13663D3 (tigm) IST15054E5 (tigm) IST11801B3 (tigm) IST12155G3 (tigm)
IST11130E10 (tigm) IST12035E12 (tigm) IST12444H7 (tigm) IST14445D2 (tigm)
IST10343H8 (tigm)
Private Clones OST463127 (lexicon) OST212031 (lexicon) OST175247 (lexicon) OST166466 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12243
Vector Insertion
Chr 8: 83315514 - 83323999
Public Clones A048E01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1247
Vector Insertion
Chr 8: 83309086 - 83312388
Public Clones DD0918 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6358
Vector Insertion
Chr 8: 83298927 - 83308525
Public Clones BGC500 (baygenomics) YHC217 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034150
Sequence
GGAGTTTCAGAGAAAGTCTGGGCTGAAGCTAGAGGCGACCGATCGTGGGAAGGGGAGGCAGAAAGGCTAGGAGGAGGAGGGCCGGGGCCCAGGCCGCGCC

TCCCCGAACCCGCCGCGCGCCCCCGGGGTGGGGGAGGAGCGCAGGGGACAGGACAGAGGGGTCCCTCCCCGAAGCAGAGCCGCCCTGCGCCTCGTCCCTG

TGCTGATCCCCGCCCTCATCCGAGGCTGGAGCGCAGACCCACCCTCCCACCGCGGACCCGCGACCTCCCCGACGCCCGGCGACGCCCTGACCCTCGCTGC

TGGTCCGCGAACTCCCTAGGCTGATCAGGACCTGCCCCTGTGCCGGCTGCCACCCGGACGCCGCACGCCTTCCCAGGCGCCCTTTTCCGAGCAGAGGGAA

AGAGAAGATCGAGCCCCTCTCAGTGTGAATGCGCCAACGGGCGGAGCGGAGCGGAGCGGACACCGCGCGCGGGCATTGTGTGTGCGCGTGCAGCGTGGGG

TCCGCAGCGGGGAGCACCCGCGGGAGGTCCCGTTTCCAAGGGGCGGAGCGCAGGGCTTCCAGTTCTGGGCTCCCTGTCCGGACAGAGTCCCAGCGGAGCC

CGACCGCTGCCTAGGCGGCGGGACGGCGCGCCTGGCGGCCAGGAGGGCGCACTGAAAGAAGGTCGGCGAGCCCTGGTCCCCGCGGTTCCCGATCGAGTTC

CTCTTCAGTCCGCGAATCTGCGGGAGAGGTTCGATCGCCGACACAGGGCGCGGGGAGCCGGGCCGCCCCGTCGGGGGAATCTGAGACGTCCTCTGGGCTG

CGTTTGACTGCCGTGCCCGCCGTGCACGGAGCGCGTCCACTGTGTCCACCGACCCCTTTGGTGTCTGGTCCTCGAGTCCTCACGGCGTGCACCATGAGCG

GCGGCGAAGTGGTTTGCTCGGGATGGCTCCGCAAGTCGCCCCCGGAGAAGAAGTTGAAGCGTTAT - UNI451 - GCGTGGAAGAGAAGGTGGTTTGT

GTTGCGCAGTGGCCGTTTGACTGGAGACCCGGATGTCCTGGAGTATTACAAAAACGATCATGCCAAGAAGCCTATTCGGATTATTGATTTAAATTTATGT

CAGCAAGTTGATGCTGGGTTGACATTCAACAAAAAGGAGTTTGAAAACAGCTATATCTTTGATATCAACACCATCGACCGGATTTTCTACTTGGTGGCAG

ATAGTGAGGAAGACATGAACAAGTGGGTCCGTTGTATCTGTGACATCTGTGGATTCAATCCCACAGAAGAAG - UNI12243 - ATCCTGTGAAGCCG

CTGACTGGCTCCTCACAAGCACCCGTCGATTCACCTTTCGCTATAAGTACAGCACCAGCCTCCAGTCAGATGGAAGCTTCTTCAGTCGCGCTACCTCCTC

CTTACCAGGTCATCAGCCTTCCGCCACACCCAGACACCCTCGGCCTCCAGGACGATCCACAAGACTACCTCTTGCTGATCAACTGTCAAAGCAAGAAGCC

TGAACCTAACAG AACCCTCTTTGACTCTGCCAAGCCCACCTTTTCTGAGACAGACTGCAATGACAACGTCCCTTCCCACCAGACTCCTGCTTCCTCCCA

GAGCAAACACGGAATGAATGGCTTTTTCCAGCAACAAATGATGTATGACTGCCCACCGTCCCGGCTGACATCTGTCTCGGGAGAGTCCAGCCTCTATAAC

CTGCCCAGGAGCTATTCCCATGACGTGTTGCCAAAGGAATCCCCATCAAGCACGGAGGCCGACGGGGAGCTGTACACCTTTAACACCCCATCTGGGACTG

CAGGTGTAGAAACGCAGATGAGACATGTATCCATCAGTTACGACATTCCGCCAACACCTGGCAACACTTACCAGATCCCACGGACATTTCCAGAAAGCAC

ACTGGGACAGTCATCAAAGCTGGACACCATTCCTGATATCCCCCCACCTCGGCCACCAAAGCCACATCCAACTCATGACCGGTCTCCTGTGGAAACGTGT

GGAGTCCCACGCACGGCCTCGGACACTGACAGCAGTTACTGTATCCCTCCTCCAGCAGGCATGACGCCCTCCCGGAGTAATACCATTTCCACCGTGGATT

TGAACAAGTTGCGGAAAG - UNI1247 - ATGCTAGTTCTCAAGATTGCTATGATATTCCACGGACCTTTCCGAGCGATAGATCTAGTTCCCTGGAAG

GCTTCCATAGCCAGTAT AAAATCAAAAGCGTGTTGACAGCGGGAGGTGTCTCGGGTGAAGAGCTGGATGAGAACTACGTTCCCATGAACCCCAACTCGC

CACCTCGACAACATTCCGGCAGCTTTACCGAGCCAATCCAGGAGCCAAACTATGTGCCAATGACCCCAGGGACCTTTGACTTTTCTTCCTTTGGAATGCA

AGTCCCTCCTCCTGCTCATATGGGCTTCAGGTCCAGCCCAAAGACCCCTCCCAGGAGGCCAGTTCCTGTTGCTGACTGTGAACCACCCCCGGTGGATAGG

AACCTCAAGCCAGACAGAAAAG - UNI6358 - TCAAGCCGGCACCTTTAGACATAAAACCTCTGTCAGAATGGGAAGAGCTGCAAGCCCCAGTCAGA

TCTCCCATCACCAGGAGCTTCGCTCGGGA CTCCTCTAGGTTTCCCATGTCCCCTCGGCCTGATTCTGTGCACAGTACGACATCGAGCAGCGACTCTCAT

GACAGTGAAGAGAACTATGTCCCCATGAATCCAAATCTGTCTGGCGAAGACCCG AATCTCTTTGCCAGCAACAGCCTTGATGGGGGAAGCAGCCCGATG

AATAAACCCAAAGGAGACAAACAAGTCGAATACCTGGATTTAGACCTAGATTCTGGGAAGTCCACGCCACCACGGAAG CAAAAGAGCAGTGGTTCTGGC

AGCAGCATGGCAGACGAGAGGGTGGATTACGTTGTGGTGGACCAACAGAAGACTCTGGCCCTGAAGAGTACCAGAGAAGCTTGGACGGATGGGAGGCAGT

CCACAGAGTCCGAGACACCCACCAAGAATGTGAAGTGAAGACATGCCGTCGCCTCTGCCGGCAGACGAGATCTGAGTGGAAAGAGAGATGCCAAGTGAAG

ATGTTCCCACTCTCAGTGGAGCCTCGAGCCAGCAGGGGCAGAGAGAAGGATCTCTCACACATGTTCAAGCAAATTAGGTTGTGAATGGTGCTGTGTGGTA

TTGGATTTATAACGTGTAAATAACCCGGGGAAATAGTGTTTTTAGTTCACAGAGAAGCTTCTGTCCCTAATTAACACACCTGTAGTATTACTATACTGAT

GCACTTTTCATTTAAAACCTTGGTTTGGGTCTTCCCGATCTACCTTAACAGACTTTCCTTGGGAGGTCTTTTGGCCTCCTCACACTACTCTATATAACAA

TACTAAGTGAACTGAGCTACTTGTAATTCTGGAAATTCCAGTTGAAGCTACAGGGCTAACACCATTAAAACAAGAAGTAAGTTGACACATTCGCTTTTCT

CTTGAAGGTGGTAGCCATTAGCTTAAGCTGTAGAACATAGTTGGACTTGTCCTTCGTTGTTTTCCAAAAATTCCGGGGATATTGTATATAGCAGGTCAAG

ACCTAGCTCTCTGACTCATGTACACTTAGGTTTTAACTGTAGGACTTTGTTATTATTATTTTTTTTGTTAATGACAGTGTTGGGTTCATCGTGTGAAGGT

TCTGCTGGGTAGGATCTTGCACCTTTCAAAGACTGCCTCTTAGTTACACTAGTAAGCCCCCAAATCATCCACAGCATGGACTGCTGGCCTGCTCTTACTC

CTGTTTATGTGTTAAACATTATCTGCAAAAGGCAGATTATACGACTGACCAATCAGGTACGTACAAGGCACTGATGTGCTAATACAGTGATTGGGTCAGA

CAAAGTGCTTCAGTTAGTGTGCGTTCGTCCTAATCTTGGTTTAGAATTAATGAAACAGTTGGCGTTCACTGTCAGCAGCATAGTGTGATTTTGAATGAAT

TAGGCAGGAATTCAAGATTACTACTCTTAGCTCGCTCGCTCTCTCTCTCTCTCCACCGTAGTGCTCTTCCTAGGGTTTTCTTTCTTCTACTTAATATCTT

CTTGGCCTTATATTTAAATCCCTATGCAATTAATGTTTTATATCTGCGTTTTTAAAAAAGAAATGTCATTTTAAGTGATTCTTGTATGTAGCAAGCACCT

ATTGCTTTTGTGAGTAAATGAATTAAGACTTTTGTACTGTGATTTGTACTCACTGCCCCAGTTCCCCAACTGTTGGAGCCTTGCTGCTGTGAAACGCTGT

AGTCACCATAGTTGTGTCCACCACCCAGCCGGGTCTGTGAGTCTCACCTGTCACGTGACATCGTCTGGTGTGGATGTTGGCTCTGAATTAGTGTCACTGC

AGTTACACGTGTCTGTCTAGGCTTTGCAAGATGCTGTAGTCACCATAGTCGTGACCACCACCTAGCCAGGTCTGTGAGTCTCACCTGTCACGTGCCATCA

TCTGGTGTCACTGCAGTTACACGTGTCTGTCTAGGCTTTGCCGCAACCTTGAGAAGCAGCTAGCATTTTCCGTTGTTCACACAGTAAGGACAATGTCTCT

GCATTGATCTGAGGCTCACTGGTGGCCTGGGGAAGGGACACAGAGAACAGAATGTCTGCAGCTGAGGCTTGTCTCTCTTCGTTCAGACCTCTTACCTGTT

GCCTGAGTACACAATGCACCCCGCTTTCTGGCCCACTGGCCACGGTGCTGTGCCTAATCTGAGTTCTCCCCTGGCTTTTCCAGTCAGTTTGAAAGCTGTG

TTCATAACTAGATGAAGTGTAGAATAGTAATATTAGATGCTTTTAAATGTTCGCTTCTTTTTAAACAAAAACTAAAACCCAGAACTGAATTTTGAGGTGG

ATTTTTAAATAAAAAAAGATTGAGTTT
Translation
MSGGEVVCSGWLRKSPPEKKLKRY - UNI451 - AWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDAGLTFNKKEFENSYIFDIN

TIDRIFYLVADSEEDMNKWVRCICDICGFNPTEED - UNI12243 - DPVKPLTGSSQAPVDSPFAISTAPASSQMEASSVALPPPYQVISLPPHPDT

LGLQDDPQDYLLLINCQSKKPEPNR RTLFDSAKPTFSETDCNDNVPSHQTPASSQSKHGMNGFFQQQMMYDCPPSRLTSVSGESSLYNLPRSYSHDVLP

KESPSSTEADGELYTFNTPSGTAGVETQMRHVSISYDIPPTPGNTYQIPRTFPESTLGQSSKLDTIPDIPPPRPPKPHPTHDRSPVETCGVPRTASDTDS

SYCIPPPAGMTPSRSNTISTVDLNKLRKD - UNI1247 - DASSQDCYDIPRTFPSDRSSSLEGFHSQY KIKSVLTAGGVSGEELDENYVPMNPNSP

PRQHSGSFTEPIQEPNYVPMTPGTFDFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKV - UNI6358 - VKPAPLDIKPLSE

WEELQAPVRSPITRSFARD DSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSGEDP NLFASNSLDGGSSPMNKPKGDKQVEYLDLDLDSGKST

PPRK QKSSGSGSSMADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPTKNVK

For any suggestions or comments, please send an email to unitrap@crg.es