Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031715 (Smarca5)
Chromosomal location
Chr 8: 83223845 - 83263358 (-)
Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 Gene [Source:MGI (curated);Acc:Smarca5-001]
RefSeq_dna
NM_053124 
RefSeq_peptide
NP_444354.2 NP_001034322.1 
UniGene
Mm.246803 Mm.404315 Mm.447222 Mm.458037 Mm.462786 
MGI
MGI:3650252 MGI:2443330 MGI:1935129 
Uniprot/SWISSPROT
Q91ZW3 
Uniprot/SPTREMBL
B2RT32 Q3U0F8 Q3URV3 Q8BVB6 
Human Ortholog
ENSG00000153147 (SMARCA5)
Omim not available
UniTrap UNI29456
Vector Insertion
Chr 8: 83260587 - 83263359
Public Clones H005H03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23740
Vector Insertion
Chr 8: 83257756 - 83260587
Public Clones not available
Private Clones OST246318 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15463
Vector Insertion
Chr 8: 83252371 - 83254095
Public Clones PST8969-NR (escells) PST8144-NR (escells) PST6347-NR (escells) PST8121-NR (escells)
IST10073F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8640
Vector Insertion
Chr 8: 83248137 - 83249888
Public Clones RRK134 (baygenomics) RRK347 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7365
Vector Insertion
Chr 8: 83232705 - 83233011
Public Clones RRU352 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19703
Vector Insertion
Chr 8: 83229479 - 83232581
Public Clones not available
Private Clones OST383116 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17968
Vector Insertion
Chr 8: 83228717 - 83229117
Public Clones not available
Private Clones OST432675 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17970
Vector Insertion
Chr 8: 83226135 - 83228503
Public Clones not available
Private Clones OST432673 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043359
Sequence
GAGGAGAAGGCGCCGGGAGGCCTCTGAGAACCTTCCGTTTTCCTTTCCCTTTCCCTCGGCCCTCCGCCTCCTCAGAGTCAGCCCGCCTTCCCTGACCTCC

GTGACCCCGCTGGCCCCGCCCACTCCCGTCGACGTGATTCCCGCCGTGAGGTAAACGCCTGTGGAGCAGAGTCCCGCGGAAGAGGACGGCGAGGCGAGCG

GCGCGGCTGGGCCGGCTCGGGTCGGTGGCGGAGCCCTCGCGCGTGAGAGCTTCCGGGCAGGTCTCACTCCTCCGGCGGCCCGGACGCCCGTGTCGCGCAG

GCCCAAGCCGCTTCCCTCGGCGCCGCGCCTGCCCGTGGCCGCGGCGGGTGACGCAGCCGGAACATGTCGTCCGCGGTGGAGCCTCCGCCGCCCCCGCCTC

CCGAGAGCGCGCCTTCCAAGCCCTCGGCGGCGGGCGCCGGCGGGAGCAGCAGCGGCAACAAAGGCGGCCCCGAGGGCGGCGCGGCGCCCGCGGCTCCGTG

TGCTGCGGGCTCGGGCCCCGCGGACACCGAGATGGAG - UNI29456 - GAAGTATTTGATCATGGATCACCTGGAAAGCAAAAAGAAATCCAAGAAC

CAGATCCTACATATGAAGAAAAAATG - UNI23740 - - UNI29456 - CAAACTGACCGAGCAAATAGATTTGAGTATTTATTAAAGCAGACAGA

GCTGTTCGCACATTTCATTCAGCCTGCTGCTCAGAAGACTCCAACCTCACCCTTGAAGATGAAACCAGGGCGCCCACGGGTAAAAAAGGATGAAAAACAG

AATTTGCTTTCAGTTGGAGA - UNI15463 - TTACCGACACCGTAGAACGGAGCAAGAGGAGGATGAAGAGCTATTAACAGAAAGTTCCAAAGCAAC

TAATGTTTGTACTCGATTTGAAGATTCTCCATCAT - UNI15463 - ATGTAAAATGGGGTAAACTGAGAGATTATCAGGTGCGAGGATTGAATTGGC

TCATCTCTCTGTATGAGAATGGCATCAATGGGATCCTTGCAGATGAAATG - UNI15463 - GGTTTGGGAAAGACACTTCAAACAATTTCTCTTCTT

GGATACATGAAACACTATAGAAATATTCCTGGTCCTCATATGGTTTTGGTTCCCAAGTCTACATTGCACAACTGGATGAGTGAATTCAAGAAATGGGTAC

CAACACTTAGGTCTGTTTGCTTGATAGGAGATAAAGAGCAAAGA GCTGCATTTGTCAGGGATGTTTTATTACCAGGAGAGTGGGATGTGTGTGTCACAT

CTTATGAAATGCTTATTAAAGAGAAGTCTGTGTTCAAAAAATTCAACTGGAGATACTTAGTTATAGATGAAGCTCACAGGATAAAAAATGAAAAATCTAA

G TTGTCAGAAATAGTGAGAGAATTCAAGACTACAAATCGGCTGTTGCTAACAGGGACGCCTCTTCAGAACAACCTGCATGAGCTCTGGTCACTTCTAAA

CTTTTTGTTACCAGATGTGTTTAATTCAGCTGAT - UNI8640 - GACTTTGATTCCTGGTTTGATACAAATAATTGCCTTGGGGATCAAAAGCTAGT

TGAGAGGCTTCATATG GTTTTGCGTCCATTCCTCCTTCGTCGAATTAAAGCTGATGTTGAAAAGAGTTTGCCTCCAAAAAAAGAAGTAAAAATCTATGT

GGGTCTTAGCAAAATGCAAAGAGAATG GTATACTCGGATATTAATGAAAGATATAGACATATTAAACTCAGCAGGGAAGATGGACAAAATGAGGCTATT

GAACATTTTGATGCAGTTGAGGAAATGCTGCAATCATCCTTATCTCTTCGATGGAGCTGAACCTGGTCCACCGTACACAACAGATATGCATCTAGTTACC

AACAGTGGCAAGATGGTGGTGTTAGACAAGCTACTCCCTAAACTGAAAGAACAAG GTTCAAGAGTACTAATCTTTAGTCAGATGACAAGAGTATTAGAC

ATTTTGGAAGATTATTGCATGTGGAGAAATTATGAGTACTGCAGGTTGGATGGACAGACACCCCATGATGAGAGACAA GACTCCATCAATGCATACAAT

GAACCAAATAGCACAAAGTTTGTATTTATGCTAAGCACACGTGCTGGTGGTCTGGGCATCAATCTTGCAACTGCTGATGTAGTCATTTTATATGACTCAG

ATTGGAATCCGCAAGTTGATCTTCAGGCTATG GACCGTGCCCATAGAATTGGACAAACGAAGACTGTCCGAGTGTTTCGCTTTATAACTGATAACACTG

TGGAAGAAAGAATAGTGGAACGTGCTGAGATGAAACTTAGACTGGATTCGATAGTAATTCAACAAG GGAGGCTTGTAGATCAGAACCTGAACAAAATTG

GGAAAGATGAAATGCTTCAAATGATTCGACATGGTGCTACACATGTGTTTGCTTCAAAAGAAAGTGAAATCACTGATGAGGATATTGATGGTATTTTAGA

AAGAGGTGCAAAGAAG ACTGCAGAAATGAACGAAAAGCTCTCCAAGATGGGTGAAAGTTCACTTAGAAACTTTACGATGGACACAGAGTCCAGTGTTTA

TAACTTTGAAGGAGAAGACTATAGAGAAAAACAAAAG ATTGCATTCACAGAGTGGATTGAACCACCAAAAAGAGAAAGAAAAGCCAACTATGCTGTTGA

TGCATATTTCAGGGAAGCTCTCCGTGTTAGTGAGCCTAAAGCACCCAAG GCACCTCGACCTCCAAAACAACCAAATGTTCAGGATTTCCAGTTCTTTCC

TCCGCGTTTATTTGAATTACTGGAAAAAGAAATTCTGTATTACAGGAAAACTATTGGGTATAAG - UNI7365 - GTACCTCGGAGTCCTGATCTACC

TAATGCAGCACAGGCACAGAAAGAGGAACAGCTAAAAATTGATGAAGCAGAGCCCCTCAATGACGAGGAGTTAGAGGAAAAAGAGAAGCTTCTGACACAG

 - UNI19703 - GGGTTTACAAATTGGAATAAGAGAGATTTTAACCAGTTTATCAAGGCTAATGAGAAGTGGGGTCGTGATGATATTGAAAATATAGC

CAGAGAAGTAGAAGGAAAAACTCCAGAAGAAGTCATTGAATACTCAG CTGTGTTCTGGGAAAGATGCAATGAGCTTCAGGACATAGAGAAGATTATGGC

TCAGATTGAAAGGGGAGAGGCAAGAATTCAAAGAAGAATAAGTATCAAGAAAGCACTAGATACAAAG - UNI17969 - ATTGGACGGTACAAAGCAC

CCTTTCATCAGCTAAGAATATCATATGGTACTAACAAAGGAAAAAACTATACTGAAGAAGAGGATCGTTTTCTCATTTGTATGCTGCACAAGCTTGGCTT

CGACAAGGAAAATGTGTATGATGAATTACGACAATGCATCCGAAACTCCCCTCAGTTTAGATTTGATTGGTTTCTCAAGTCCAGAACTGCGATG - UNI

17970 - GAGCTCCAGAGGAGGTGTAATACCTTAATTACTTTGATTGAAAGAGAAAATATGGAACTAGAAGAAAAGGAGAAGGCAGAGAAAAAGAAAAG

AGGACCAAAACCTTCC ACACAGAAACGTAAGATGGACGGTGCCCCTGATGGCCGTGGAAGAAAAAAGAAGCTGAAACTATGAATGCATTTTTGTCTTAT

AATCACTAACTGGTAGTTCTTTAATTTACGGGTCTTCATAAGATGTGCTGTACAGTGCTCAACTGTTATGTCATTCAGACATCAGGTCCATCTGCTTACT

GAGCTAGAAACATAGTATGTAGTTTCACTTTTTTTAAATGCAACAGCTGTGCTGAAATTTTTTTTATCATTAACAATTGAAGTAATAAAACAGGCTTCAT

TTATTAATAAATGTTTCATTTGATTTATTTTTCTAATAGTTTCATTTGTGAGGATTGTGGCTTTTTATCAGCTACTTTAACACTTGTATGGCTTAAAAAC

AAGCAAACAAGTAAAAAAATACTGCAGATAACATTTGATTGGTCCCTTCAGCTTGGTTGTGTAATTAATTACTTCACATTCTTTGCCTTTGCTGATTTTT

TTTTTTTTTTGTGGTACTATTGAGTCTCATCTGGAAAGATTGTAAATTGCATTCTTGCTTATTATAGAATGGGGAAGACAAGTATTAATAATTTTCTATG

CATATTTCTGTTATACTTTCTGTTCCTATGGTTCTGATGTGAATGTGTCCTATTTTGTTGGATGAATGGCCTTTTTTAGTTGTATAGCCAAAGACATTTA

GTATTTTCTGGTTCTTTAAGGTGATGTATTATTTTGTAAAAGGAATTTTTTTAAGTATTTGGAAAATATTTTGACAAATGGCCTTGCAGCAGCCACAAGA

TAATGTCAGAAGTAAGGTGATTTTTTTTTTTTTAAATTTGAATGACCCAGCCAAAATGAGGTTTGAATTTGTCATACTGTTATAATACTAATAGAATGTA

CCCTCTCAGTTTATAGTATTTTTGAGTTTTTAGAGTAAATGAAAATTTTATTTTATTATATTTTAAAAATAACTTCTAAGTCTTAGTAGCAAGATGGAGT

ATAATTCCAGTTTTTATTTTCTATGGAATAGACTGGTAAACTGGAGACCCTGAAGCAGGAATACCCAGAGGCCTTTATGTGCTACACATCATTTGTATAA

AGTTTTATATGTGCAAATTGGGTACATAAGCAGTTCTCCATTTTTCTAAGGGAATGCAATAAATGTAGCATCGTGAATAAATATAACTTTTATAATCCTT

Translation
MSSAVEPPPPPPPESAPSKPSAAGAGGSSSGNKGGPEGGAAPAAPCAAGSGPADTEME - UNI29456 - EVFDHGSPGKQKEIQEPDPTYEEKM - 

UNI23740 - - UNI29456 - QTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRVKKDEKQNLLSVGD - UNI15463 - DYRHRR

TEQEEDEELLTESSKATNVCTRFEDSPSY - UNI15463 - YVKWGKLRDYQVRGLNWLISLYENGINGILADEM - UNI15463 - GLGKTLQTI

SLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKKWVPTLRSVCLIGDKEQR AAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKN

EKSK LSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSAD - UNI8640 - DFDSWFDTNNCLGDQKLVERLHM VLRPFLLRRIKADV

EKSLPPKKEVKIYVGLSKMQREW WYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQ

G GSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQ DSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAM DRAH

RIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQG GRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKK TAEMNEK

LSKMGESSLRNFTMDTESSVYNFEGEDYREKQK IAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPK APRPPKQPNVQDFQFFPPRLFELLEKEI

LYYRKTIGYK - UNI7365 - VPRSPDLPNAAQAQKEEQLKIDEAEPLNDEELEEKEKLLTQ - UNI19703 - GFTNWNKRDFNQFIKANEKWGR

DDIENIAREVEGKTPEEVIEYSA AVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTK - UNI17969 - IGRYKAPFHQLRISYGTNKGKN

YTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAM - UNI17970 - ELQRRCNTLITLIERENMELEEKEKAEKKKRGPKPS 

TQKRKMDGAPDGRGRKKKLKL

For any suggestions or comments, please send an email to unitrap@crg.es