Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031727 (Pmfbp1)
Chromosomal location
Chr 8: 112017927 - 112066540 (+)
Description
polyamine modulated factor 1 binding protein 1 Gene [Source:MGI Symbol;Acc:MGI:1930136]
RefSeq_dna
NM_019938 
RefSeq_peptide
NP_064322.1 
UniGene
Mm.42166 
MGI
MGI:1930136 
Uniprot/SWISSPROT
Q9WVQ0 
Uniprot/SPTREMBL
B2RR67 Q8CEM3 
Human Ortholog
ENSG00000118557 (PMFBP1)
Omim not available
UniTrap UNI14077
Vector Insertion
Chr 8: 112065775 - 112066287
Public Clones CMHD-GT_137H7-3 (cmhd) CMHD-GT_434H4-3 (cmhd)
Private Clones OST28126 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034162
Sequence
GCTTATATTAGGGATGGGGGATGTAGCTTATCACAAAGAATGAGTATTTGGTGGCTTCTCATTCTTGGAACCATTCTGCAG GTTTACAAAAATGCTAAA

GCTTAAAGGAGAATTACGAACTGCCAAGGGACTGAAGAATGAG GCTGGGGAGAGAGACAGGGATGTCAGCAATCTAAACAGCAAGCTCTTGAGCCTACA

ACTGGACATCAAGAATCTCCACGATGTCTGCAAGAGGCAGGGGAAGACCTTGCAAGAGAACCAGCTCTGCGTGGAGGAAGCGATGCTGAAAGCCAACCAC

 AACAAGAAGCAAGCCCAGACGTTAGTATTCACGGACAACCAGATGGACTTCCGGGTCAATAAGCAATACCATCTCAGGCAACTCCAGCAACTGAAGAAG

AAGCTGCTGACCCTCCAGCAGGAACTGGAGTTCCGTACCCAGGAGCTCCAGGCTTCCTACTGCTCTCTCCTGCAGTACCAGTCGATCCTGGAGAAGCAGA

CTTCCGACCTTCTTGTTCTTCACCGTCACTGCAAACTTAAGGAAGATGAG GTCATTCTCTACGAGGAGGAGATGGGAAATCATAGTAAGAGCACGGGGG

AGAAACTCCATCTGGCGCAAGAGCAGCTTGCCTTGGCGGGGGACAAGATCCTCTCCCTAGAAAGGAGCCTAAACCTCTACAGGGACAAGTACCAGACTTC

CCTGAGCAACATAGAGTTACTGGAGTGCCAAGTGAAGATGCTGGAGGGGGAACTCAGCGGACTCATTGGTCAG GACCCTGAGAACAAAGGAGACCACCC

GAAGGTTCGAATCTACACTTCTCCGTGCGTGATTCAAGAGCATCAGGAGACCCTAAAGCGACTGTCTGAAGTCTGGCAAAAGGTTTCTGAACAGGATGAC

CTAATCCAGGAGCTTCGGAATAAACTGGCCTGCAGCAACTCTTTG GTCCTGGAGCGTGAGGAGGCGTTGATAAAATTACAAGCTGAGTTTGCTTCCTAC

ACAGCCACCCACCGGCATCCCCCTACCTCCTCAGAAGACTGTGAAGACATCACAAAG ATCCTGAAGCACCTGCAAGAGCAGAAAGACAGCCAGTGCCTG

CACGTGGAGGAGTACCAGAACCTTGTGAAGGACCTGCGCATGGAGCTGGAAGCTGTGTCAGAACAGAAGAAAAAGATCATGAAGG ACATGATGAAGCTG

GAGCTAGATCTACATGGGCTGCGGGAAGAGACGTCCTGCGTCATCGAGAAGAAGGACAAGGAGACTGTCTTCCTGCAGTACCGGCTGCAAGATCTGCAGC

AACAGTACACAGAGTCACAGAAGCTGTCCCTGAAGAAGGACAAG TTGCTCCAAGACAAGGATGAGAGGCTGCACGAGCTGGAGAAGAATCTGATGCAGG

TGCAGAACAGCCTCAGAGAGAAAGAGGCAGAGCTGGAGAAGCTACAGTGTACAACCAAAGAACTGGACACCAGCCTCCAAGAAGCTAGGCAAAGCACATC

CAAAATAGACTGCGAGGCCCTGCGGGCCGAGATCCAGAAGCTCAAGGATAGCCTCGAGGAGGCCAGGGAGCAGCTGAAGGTGTCAG ATCAGAATCTAAC

CCAGAGTAAGGAGGAAGCGCACCTCTCTGCCAGCAGCCTAGAGGATGCTCATCGGAAAATCGAGAACTGCCTTCTCCAGGACAAGCAGAAGGAAGAGGTC

ATTAAGGATCTGCAGAGCCAGTTGCATAAGCTACAGAAGGAGTCTTCGAAAATTGAGGAGGAACGAAAACACAACAG GCAACGGTTACAGGAGCTGAGC

TCGGAACTCTCTGAAGGCCAGAGAAGGCTTTCGAATGCAGAGAAGGAAAAGTCGCTGCTTCAGAAGACACTGGATGAAGACGAGAAAAAGATAGATGAGC

TATTTCACAGCACCCAAGTCTCTGAGCAAAAG CAAAGGGAGCTAACAAACTCCATAAGGAAGCTAGAGGAGGAACTTCTGGAGATAAAAGGGCTCTTGG

AGGAGAAACGAGAGCAACTGAAGAAGAGTAAGGAACAGGAGAAGGCACTGGAGGAAGAGATCGAGGCTTTGCGACAAGAAGCGAAAAGGAAAGAGAAGAT

G GCGAAGGAACATTTGAGAAAGCTGGATGAAGAGAAGGAGAACCTGCAGGCTGAGTTGACCTCCCGTTCCTCACACCTGGACTCCTCTCTCAACAAATA

CAACTCCTCCCAGAAAGTCATCCAAGAGCTCAACGCGGAG ATAGCCCGCCAGAAGGATTCCATCATGATTCTGCAGACACAGCTGGATTCGGCTATCCA

GAAAGAGAAGAACTGTTTCCAGAACATGGTTAGTAAAGAAGCTTATGAGGAACTTGTGCGGAAGTCGGGCAACTGCCAGGACGACCTGACACAGGCCCTG

GAGAAG CTCACTCAGGCAACCTCAGAGACAAAGAGCCTGAATCGCTCCTTGCAACAGACCCAGGAGAGGAAAGCTCAACTGGAAGATGAAATCGCGGCT

TATGAGGAAAGGATGAAAAAGCTCAATATGGAGTTAAAAAAACTGCAGGGCTTCCAACAGCAGAGCGAGCAAGAG GTGCACAACTTTGACAAGAAGCTG

GAGGAGATGAGCAACCAGGTGTTGCAGTGGCAGAGGCAGCACCAGAGTGACCTTAAGATGTTGGCAGCTAAGGAGTCGCAGCTCCGAGAATTCCAGGAGG

AAATGGCGACCCTAAGAGAGAGCCTCCTTGCAGATGAGAAGGAG CCGTACTCCCCGCCTGCAAAGCTAACCCCCAAAGAAACCTGCAGGCACCACCGGG

AGAATGACCAGATTATGAACAACGTGGAACAATGGGCAAAGGAGCAGAA GATTGCCAATGAGAAGTTGGGAAACAAGCTGAGAGAGCAGGTTAAATACA

TTGCCAAGTTGACTGGCGAAAAGGA CCACCTCCACAATGTAATGGTCCACCTGCAGCAGGAGAACAAAAAGCTGAAGAACGAGATAGAAGAGAAGAAGC

TAAAGGCCGGGAACCCGAGGATCTGTGTCAAGGCCTTTCCCCCAAACAAACTGGAGCCTTCCCAAAAGGGAAAGCTATGCTGTGCCCTGGGCTGGAGAGG

GATACCCCAGGACCTGACACCGAAAACGGACCACAAGTACATGGGGTTACCTCACTCCTCAG - UNI14077 - GCTCCTCCTACTGCTAGAATCGGC

TCTTCACCCAAAGCGTCACTGCTACACGTTTTCAGAGGACATTGAGTCCCCACCCCTCTTTCTTGACCGGAACCAGCTCCTACAGTGGTCCATCAAGGCC

CCTGTCTAGTTTGCAAGAAGTTATGCTTTGCTGAGTTTTGTCTACCTCCTGAAGTAGAGTTGTAAGACCCCACTCCCCCCAGCCTCCGGGCCCAGACTCT

GAAATAAAGATACAAACAACAAGGCCTCC
Translation
 MLKLKGELRTAKGLKNE AGERDRDVSNLNSKLLSLQLDIKNLHDVCKRQGKTLQENQLCVEEAMLKANH NKKQAQTLVFTDNQMDFRVNKQYHLRQL

QQLKKKLLTLQQELEFRTQELQASYCSLLQYQSILEKQTSDLLVLHRHCKLKEDE VILYEEEMGNHSKSTGEKLHLAQEQLALAGDKILSLERSLNLYR

DKYQTSLSNIELLECQVKMLEGELSGLIGQ DPENKGDHPKVRIYTSPCVIQEHQETLKRLSEVWQKVSEQDDLIQELRNKLACSNSL VLEREEALIKL

QAEFASYTATHRHPPTSSEDCEDITK ILKHLQEQKDSQCLHVEEYQNLVKDLRMELEAVSEQKKKIMKD DMMKLELDLHGLREETSCVIEKKDKETVF

LQYRLQDLQQQYTESQKLSLKKDK LLQDKDERLHELEKNLMQVQNSLREKEAELEKLQCTTKELDTSLQEARQSTSKIDCEALRAEIQKLKDSLEEARE

QLKVSD DQNLTQSKEEAHLSASSLEDAHRKIENCLLQDKQKEEVIKDLQSQLHKLQKESSKIEEERKHNR RQRLQELSSELSEGQRRLSNAEKEKSLL

QKTLDEDEKKIDELFHSTQVSEQK QRELTNSIRKLEEELLEIKGLLEEKREQLKKSKEQEKALEEEIEALRQEAKRKEKM AKEHLRKLDEEKENLQAE

LTSRSSHLDSSLNKYNSSQKVIQELNAE IARQKDSIMILQTQLDSAIQKEKNCFQNMVSKEAYEELVRKSGNCQDDLTQALEK LTQATSETKSLNRSL

QQTQERKAQLEDEIAAYEERMKKLNMELKKLQGFQQQSEQE VHNFDKKLEEMSNQVLQWQRQHQSDLKMLAAKESQLREFQEEMATLRESLLADEKE P

YSPPAKLTPKETCRHHRENDQIMNNVEQWAKEQK KIANEKLGNKLREQVKYIAKLTGEKD DHLHNVMVHLQQENKKLKNEIEEKKLKAGNPRICVKAF

PPNKLEPSQKGKLCCALGWRGIPQDLTPKTDHKYMGLPHSSG - UNI14077 - GSSYC

For any suggestions or comments, please send an email to unitrap@crg.es