Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031732 (Phlppl)
Chromosomal location
Chr 8: 112392546 - 112464808 (+)
Description
PH domain and leucine rich repeat protein phosphatase-like Gene [Source:MGI Symbol;Acc:MGI:2444928]
RefSeq_peptide
NP_001116066.1 
UniGene
Mm.23494 
MGI
MGI:2444928 
Uniprot/SWISSPROT
Q8BXA7 
Uniprot/SPTREMBL
Q148U6 
Human Ortholog
ENSG00000040199 (PHLPPL)
Omim not available
UniTrap UNI30679
Vector Insertion
Chr 8: 112400984 - 112419407
Public Clones IST11882F11BBF1 (tigm) IST11882F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034175
Sequence
GGCCCGCTGGAGCCCCCGGAGCCACCTGAAGCGGCGGCGCCTCGCCGGCCCGGAGGGATTCGGGTCCTAAAG AGAAATATGAAACACAATGGGAGCAGA

ACTTGTTTGAATAGAAGAAGTAGGTTTGGTTCCCGAGAAAGAGACTGGCTAAGAGAAGATGTGAAGAGAGGCTGTGTTTACCTTTATGGAGCAGACACGA

CCACTGCCACTACAACCACCTCCTCCTCCTCCTCCTCCTCCTCCTCTTCTGATTTACATCTTGTCCTTTGCACAGTAGAGACACCAGCGTCAGAAATATG

TGCTGGAGAGGGAAGAGAAAGCCTCTATCTACAGCTTCATGGAGATCTGGTCAG - UNI30679 - GAGACTGGAGCCCTCTGAACGGCCTCTCCAGA

TTGTTTACGATTACTTATCCAGGCTGGGGTTTGAAGATCCCGTGCGCATACAGGAGGAGGCTACGAACCCTGACCTCAGCTGTATGATTCGATTTTATGG

TG AAAAACCATGCCAGATGGATCATCTGGATCGAATCCTACTGTCTGGCATCTATAATGTACGCAAAGGAAAAACCCAGCTGCACAAATGGGCTGAGCG

CCTCGTTGTTCTCTGTGGTACCTGCCTTATTGTTTCCTCAGTGAAGGATTGTCAAACTGGAAAGATGCACATTTTGCCGCTGGTTGGGGGAAAG ATAGA

AGAAGTGAAGCGCCGGCAGCACTCCCTTGCTTTCAGCTCAGCTGGAGCCCAAGCTCAGACCTATCATGTCAGCTTTGAGACTTTGGCTGAGTACCAGAGA

TGGCAACGGCAGGCGTCTAAG GTGGTGTCGCAGCGGATGAGCACTGTGGACCTCTCATGCTACAGCCTTGAAGAGGTTCCTGAGCATCTCTTCTACAGC

CAAGACATCACCTACCTCAACCTGCGGCACAACTTCATGCAGCTAGAAAGACCAGGGGGCCTTGACACACTCCACAA ATTTTCTCAACTGAAGGGCCTG

AACTTGTCCCATAATAAACTTGGACTGTTTCCTGTGCTGCTGTGTGAGATTTCTACCCTGACTGAGCTCAGCCTTTCTTGTAATGGATTTCATGACTTGC

CAAGTCAGATTGGTAAATTGCTAAA TCTTCAGACCCTCAGCCTCGACGGCAACGGCCTCACGGCTCTGCCAGATGAGTTGGGAAACCTGCGGCAGCTCA

CTTCTCTGGGAATTTCCTTCAACGATTTTCGTCACATCCCTGAAGTTTTGGAGAAACTTACCATGTTAGATAAAGTGGCTATGGCAGGAAACCGTTTGGA

GGTCCTGAACCTGGGGGCACTGACCAGGATGAGCCAGGTCAAGCACGTGGATCTGAG GATGAACCACTTGAAAACGGTGATTACTGAAAATATGGAAGG

AAATAAACATATCACGCACATGGATTTGCGGGACAATCAGTTGACTGATTTGGACCTTAGCTCCTTATGTAGCTTGGAGCAGCTGCACTGTGAGCGGAAC

CAGCTGAGGGAGCTGACACTCAGCGGCTTCTCCCTTCGAACCCTCTACGCCAGTTGGAACA GGCTGACGGCAGTGAATGTGTACCCAGTGCCCAGCCTG

CTCACTTCTTTGGAGCTCTCCCA AAACTTGCTGGAGTGTGTCCCTGACTGGGCCTGTGAAGCAAAAAAGCTGGAAATACTAGACATAAGCCACAATCTT

CTTACAGAGGTCCCCATGAG AATTCTGAGTAGTCTGAGTCTTCGGAAACTGATGGTAGGACACAATCACATCCATGTCCTTCCTGCACTGGTGGAGCAC

ATTCCCCTCGAGGTCCTGGATATCCAGCATAACACTCTCTCCAGGCTGCCGGACACGCTCTTCTCCAAGGCCTTAAA TCTCAGGTACTTGAATGCATCT

GCAAATAGTCTGGAGTCCTTGCCTTCTGCGTGTGCTGGAGAGGAGAGTCTGAGTGTGCTGCAGCTGCTGTACCTGACCAGCAACCTTCTGACAGATCAGT

GCATACCAGTTTTGGTCGGGCACCCACACCTGCGAGTTCTGCACCTTGCAAACAACCAGCTCCAGACCTTCCCTGCAAG CAAGCTAAATAAACTGGAGC

AGCTGGAAGAGCTGAATCTAAGTGGGAACAAACTTACAGCTATCCCCACAACCATAGCCAACTGCAAAAGGCTGCACACCCTTGTCGCCCATGCCAACAA

CATCAGCATCTTCCCAGAGATCCTGCAGCTGCCTCAGATTCAG TTTGTAGACCTGAGTTGCAATGACTTGACAGAAATCCTAATTCCAGAAGCTCTGCC

TGCTACTTTACAAGACCTTGATCTGACAGGAAATACAAATCTGGTCCTGGAACATAAGACTTTGGACATGTTTAG CCACATCACAGCCCTGAAGATTGA

TCAGAAGCCTTTGCCAGCCACAGACTCTGCAGTTACATCAACCTTCTGGAGCCATGGCCTGGCCGAGATGGCAGGGCAGAGGAATAA ACTCTGTGTGTC

TGCCCTGGCTATGGATAACTTTGCAGAGGGTGTGGGAGCTGTCTACGGCATGTTTGATGGGGACCGGAATGAAGAACTCCCTCGTCTGCTGCAGTGTACA

ATGGCAGATGTGCTTTTGGAAGAAGTACAGCACTCAACAAATGACACAGTTTTCATGACCAATACCTTCTTGGTATCTCACAG GAAATTAGGAATGGCT

GGCCAGAAGCTGGGTTCTTCGGCTCTCCTGTGCTATATTCGACCTGACACTGCCGACCCAACAAGTAGCTTTAGCTTGACTGTAGCCAATGTTGGCATGT

GCCAAGCTGTCCTGTGCCGAGGTGGGAAGCCAGTACCTCTTTCTAAAGTCTTCAGCTTGGAGCATGACCCAGAGGAGGCTCAGAGGGTGAAAGACCAGAA

AGCCATCATAACAGAG GACAACAAGGTGAACGGAGTAACCTGCTGCACCCGGCTGCTGGGGTGCACATACCTCTACCCATGGATCCTCCCCAAGCCCCA

CATAGCTTCCACTCCACTTACCATTCAAGATGAATTGCTGATTTTGGGAAACAAAGCACTGTGGGAACACTTGTCATATCTAGAAGCTGTCAATGCAGTA

CGTCACGTGCAAGACCCACTAGCTGCTGCTAAGAAGCTGTGCACATTAGCCCAGAGCTACGGTTGTCAGGACAACGTGGGGGCAATGGTGGTTTATTTGA

ATATTGGTGAAGAAGGCTGTACCTGTGAAATGAATGGGCTCACCCTTCCAGGCCCTGTGGGATTTGCTTCAACTGCAGCCCTCAAGGATACTCCCAAGCC

AACCACTCCCTCCTCCAGTAGTGGGATTGCCTCCGAGTTCAGCAGTGAGATGTCCACCTCAGAGGTGAGCAGTGAAGTGGGCTCCACGGCCTCGGATGAG

CACAACACTGTGGGCCTGGAGGCGAGCTTGCTGCCCAGGCCAGAGAGGCGCTGCAGTCTGCACCCAGCGTCCTCCGCAGGGGTGTTCCAGCGCCAGCCTT

CTTGTGCTACTTTTTCCAGCAATCAGTCTGACAATGGCCTGGACAGTGACGATGACCAGCCTGTTGAAGGAGTCATAACCAACGGCAGCAGGGTTGAAGT

AGAGGTAGACATCCATTGCTGCCGAGGCAGAGAGCCAGAGAGCTCCCCTCCGCTCCCGAAGAACTCTTCCAACGCCTGTTCAGAGGAGCGTGCTAGAGGG

GCGGGGTTTGGGATCCGAAGACAGAACAGTGTCAACAGTGGTATACTTCTGCCAGCGAACAGAGACAAGATGGAGCTGCAGAAGTCTCCCTCCACTTCTT

GTCTGTATGGAAAGAAACTCTCCAATGGCTCCATTGTGCCCCTAGAGGACAGCCTGAACCTCATTGAGGTGGCCACAGAAGCACCCAAAAGGAAAACTGG

CTACTTTGCTGCCCCCACTCAGCTGGAACCAGAGGATCAGTTTGTCGTCCCTCGAGACCTGGAAGAGGAAGTGAAGGAGCAGATGAAGCAGCACCAGGAG

GGCAGGCCTGAGCCCGAGCCCCGGGGAGAGGAGCGGACAGAGCCCCTGGAGGAGTTTGATACAGCACTGTGA
Translation
 MKHNGSRTCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTSSSSSSSSSSDLHLVLCTVETPASEICAGEGRESLYLQLHGDLVR - UNI3

0679 - RRLEPSERPLQIVYDYLSRLGFEDPVRIQEEATNPDLSCMIRFYGE EKPCQMDHLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSS

VKDCQTGKMHILPLVGGK IEEVKRRQHSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASK VVSQRMSTVDLSCYSLEEVPEHLFYSQDITYLNLRHNF

MQLERPGGLDTLHK KFSQLKGLNLSHNKLGLFPVLLCEISTLTELSLSCNGFHDLPSQIGKLLN NLQTLSLDGNGLTALPDELGNLRQLTSLGISFND

FRHIPEVLEKLTMLDKVAMAGNRLEVLNLGALTRMSQVKHVDLR RMNHLKTVITENMEGNKHITHMDLRDNQLTDLDLSSLCSLEQLHCERNQLRELTL

SGFSLRTLYASWNR RLTAVNVYPVPSLLTSLELSQ QNLLECVPDWACEAKKLEILDISHNLLTEVPMR RILSSLSLRKLMVGHNHIHVLPALVEHIP

LEVLDIQHNTLSRLPDTLFSKALN NLRYLNASANSLESLPSACAGEESLSVLQLLYLTSNLLTDQCIPVLVGHPHLRVLHLANNQLQTFPAS SKLNKL

EQLEELNLSGNKLTAIPTTIANCKRLHTLVAHANNISIFPEILQLPQIQ FVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDMFS SHITA

LKIDQKPLPATDSAVTSTFWSHGLAEMAGQRNK KLCVSALAMDNFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLLEEVQHSTNDTVFMTNTFLVSHR

 RKLGMAGQKLGSSALLCYIRPDTADPTSSFSLTVANVGMCQAVLCRGGKPVPLSKVFSLEHDPEEAQRVKDQKAIITE DNKVNGVTCCTRLLGCTYLY

PWILPKPHIASTPLTIQDELLILGNKALWEHLSYLEAVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGCTCEMNGLTLPGPVGFASTA

ALKDTPKPTTPSSSSGIASEFSSEMSTSEVSSEVGSTASDEHNTVGLEASLLPRPERRCSLHPASSAGVFQRQPSCATFSSNQSDNGLDSDDDQPVEGVI

TNGSRVEVEVDIHCCRGREPESSPPLPKNSSNACSEERARGAGFGIRRQNSVNSGILLPANRDKMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVAT

EAPKRKTGYFAAPTQLEPEDQFVVPRDLEEEVKEQMKQHQEGRPEPEPRGEERTEPLEEFDTAL

For any suggestions or comments, please send an email to unitrap@crg.es