Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031748 (Gnao1)
Chromosomal location
Chr 8: 96334738 - 96493287 (+)
Description
guanine nucleotide binding protein, alpha O Gene [Source:MGI Symbol;Acc:MGI:95775]
RefSeq_dna
NM_010308 
RefSeq_peptide
NP_001106855.1 NP_034438.1 
UniGene
Mm.251445 
MGI
MGI:95775 
Uniprot/SWISSPROT
P18872 
Uniprot/SPTREMBL
Q543S2 
Human Ortholog
ENSG00000087258 (GNAO1)
Omim not available
UniTrap UNI29681
Vector Insertion
Chr 8: 96420273 - 96468097
Public Clones E119C03 (ggtc) D131F01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034199
Sequence
ACTCCCTCCACACCCCGCGCCACCGCCGCCTCCACCTTCTCCGCCTCCGCCTCCTCCTCCTCCGCCTCCGGCAGCCGCGGCAGAAGGACCCACCCTGCCC

CCCACCCCACCCTCCGCCGGCTCCGGCTGCGGATCCAGCCTCGACTCCTATTTTATTTATTTTGGGTCGTGCACTAGCCTCGGTGCCTGCAACCCGCGCC

TCCCGGGCCCGCGGGCGCCTCCTCTCTCGGCTCCGGAGCCCCAGACCCCGGCTACCCTCACCTCGACACCCCCAGACCCCAGCCAGCCGCCGCTAATCTT

CGCCGCTGGAATCTTAATAGAGGCTGTCCTTTTGGGGGGATTCTGGTCTTTCGACAATTTTGTTCCCAGCCAAGGAGAGGATATCGTGATTTTCTCCCCT

TTGAGCCCAGGCTCTGCTCTGTGGGGGGGTGGGGGGCGCGCCGACCCGGGGAGTCGTGCCAGCCTAGTCGTGCGGGCTGTGGCAGGGAAGGGGCCACCAT

GGGATGTACGCTGAGCGCAGAGGAGAGAGCCGCCCTCGAGCGGAGCAAGGCGATTGAGAAAAACCTCAAAGAAGATGGCATCAGCGCCGCCAAAGACGTG

AAATTACTCCTGCTGG GGGCTGGAGAATCAGGAAAAAGCACCATTGTGAAGCAGATGAA GATCATCCATGAAGATGGCTTCTCTGGGGAAGACGTGAA

GCAGTACAAGCCTGTGGTCTACAGCAACACCATCCAGTCTCTGGCGGCCATTGTCCGGGCCATGGACACTTTGGGCGTGGAGTATGGTGACAAGGAGAGG

AAG - UNI29681 - ACGGACTCCAAGATGGTGTGTGACGTGGTGAGTCGTATGGAAGACACTGAACCGTTCTCTGCAGAACTTCTTTCTGCCATGAT

GCGACTCTGGGGCGACTCGGGGATCCAGGAGTGCTTCAACCGATCTCGGGAGTATCAGCTCAATGACTCTGCCAAATA CTACCTGGACAGCCTGGATCG

GATTGGAGCCGGTGACTACCAGCCCACTGAGCAGGACATCCTCCGAACCAGAGTCAAAACAACTGGCATCGTAGAAACCCACTTCACCTTCAAGAACCTC

CACTTCAG GCTGTTTGACGTCGGGGGCCAGCGATCTGAACGCAAGAAGTGGATCCACTGCTTTGAGGATGTCACGGCCATCATCTTCTGTGTCGCACTC

AGCGGCTATGACCAGGTGCTCCACGAGGACGAAACCACG AACCGCATGCACGAATCCCTGAAGCTCTTCGACAGCATCTGCAACAACAAGTGGTTCACA

GACACATCTATTATCCTGTTTCTCAACAAGAAGGACATATTTGAGGAGAAGATCAAGAAGTCCCCACTCACCATCTGCTTTCCTGAATACACAG GCCCC

AGTGCCTTCACAGAAGCTGTGGCTCACATCCAAGGGCAGTATGAGAGTAAGAATAAGTCAGCTCACAAGGAAGTCTACAGCCATGTCACCTGTGCCACGG

ACACCAACAACATCCAATTCGTCTTTGATGCCGTGACAGATGTCATCATCGCCAAAAACCTACGGGGCTGTGGACTCTACTGA
Translation
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG GAGESGKSTIVKQMK KIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYG

DKERK - UNI29681 - TDSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKY YYLDSLDRIGAGDYQPTEQDILRTRV

KTTGIVETHFTFKNLHFR RLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETT NRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEE

KIKKSPLTICFPEYTG GPSAFTEAVAHIQGQYESKNKSAHKEVYSHVTCATDTNNIQFVFDAVTDVIIAKNLRGCGLY
Transcript ENSMUST00000034198
Sequence
ACTCCCTCCACACCCCGCGCCACCGCCGCCTCCACCTTCTCCGCCTCCGCCTCCTCCTCCTCCGCCTCCGGCAGCCGCGGCAGAAGGACCCACCCTGCCC

CCCACCCCACCCTCCGCCGGCTCCGGCTGCGGATCCAGCCTCGACTCCTATTTTATTTATTTTGGGTCGTGCACTAGCCTCGGTGCCTGCAACCCGCGCC

TCCCGGGCCCGCGGGCGCCTCCTCTCTCGGCTCCGGAGCCCCAGACCCCGGCTACCCTCACCTCGACACCCCCAGACCCCAGCCAGCCGCCGCTAATCTT

CGCCGCTGGAATCTTAATAGAGGCTGTCCTTTTGGGGGGATTCTGGTCTTTCGACAATTTTGTTCCCAGCCAAGGAGAGGATATCGTGATTTTCTCCCCT

TTGAGCCCAGGCTCTGCTCTGTGGGGGGGTGGGGGGCGCGCCGACCCGGGGAGTCGTGCCAGCCTAGTCGTGCGGGCTGTGGCAGGGAAGGGGCCACCAT

GGGATGTACGCTGAGCGCAGAGGAGAGAGCCGCCCTCGAGCGGAGCAAGGCGATTGAGAAAAACCTCAAAGAAGATGGCATCAGCGCCGCCAAAGACGTG

AAATTACTCCTGCTGG GGGCTGGAGAATCAGGAAAAAGCACCATTGTGAAGCAGATGAA GATCATCCATGAAGATGGCTTCTCTGGGGAAGACGTGAA

GCAGTACAAGCCTGTGGTCTACAGCAACACCATCCAGTCTCTGGCGGCCATTGTCCGGGCCATGGACACTTTGGGCGTGGAGTATGGTGACAAGGAGAGG

AAG - UNI29681 - ACGGACTCCAAGATGGTGTGTGACGTGGTGAGTCGTATGGAAGACACTGAACCGTTCTCTGCAGAACTTCTTTCTGCCATGAT

GCGACTCTGGGGCGACTCGGGGATCCAGGAGTGCTTCAACCGATCTCGGGAGTATCAGCTCAATGACTCTGCCAAATA CTACCTGGACAGCCTGGATCG

GATTGGAGCCGGTGACTACCAGCCCACTGAGCAGGACATCCTCCGAACCAGAGTCAAAACAACTGGCATCGTAGAAACCCACTTCACCTTCAAGAACCTC

CACTTCAG GCTGTTTGACGTCGGGGGCCAGCGATCTGAACGCAAGAAGTGGATCCACTGCTTTGAGGATGTCACGGCCATCATCTTCTGTGTCGCACTC

AGCGGCTATGACCAGGTGCTCCACGAGGACGAAACCACG AACCGCATGCACGAGTCTCTCATGCTCTTCGACTCCATCTGTAACAACAAGTTTTTCATT

GATACCTCCATCATCCTCTTCCTCAACAAGAAAGACCTCTTTGGCGAGAAGATTAAGAAGTCACCCTTGACCATCTGCTTTCCCGAATACCCAG GCTCC

AACACCTATGAAGATGCAGCTGCCTACATCCAAACACAGTTTGAAAGCAAAAACCGCTCACCCAACAAAGAAATTTACTGTCACATGACTTGTGCCACAG

ACACGAATAATATCCAGGTGGTATTCGACGCCGTCACCGACATCATCATTGCCAACAATCTCCGGGGCTGCGGCTTGTACTGACCTCTTGTCCTGTATAG

CAACCTATTTG ACTGCTTCATGGACTCTTTGCTGTTGATGTTGATCTCCTGGTAGCATGACCTTTGGCCTTTGTAAGACACACAGCCTTTCTGTACCAA

GCCCCTGTCTAACCTACGACCCCAGAGTGACTGACGGCTGTGTATTTCTGTAGAATGCTGTAGAATACAGTTTTAGTTGAGTCTTTACATTTAGAACTTG

AAAGGATTTTAAAAAACAAAACAAAAACCATTTCTCATGTGCTTTGTAGCTTTAAAAGAAAAAAGGAAAACTCACCATTTAATCCATATTTCCTTTTTAT

TTTGAAGTTTAAAAAAAAAATGTCTGTACCCACACCCTCCCCCTTCCCCACCTCAGCAGAACTGGGGCTGGCACACAGAGGCAGTGCTGGGCCTGGCGCC

TCCCAGGGCTTCTGTGCAGCCCATGGCTGGTGGGAACATGTCAGGCTAGTCTGTCTAGAAGGCCACTGGCCACTGTACCCACCCTTCCCCATGCCTGTGG

GCTGCCCAGACACCTCATATACCACCAGGCAGTGGCAGCTCCGCCCTGCTCAGCCACGCGACTCCAAACACACTCAAAGTTTGCGTAGAAAAAGCACAGC

TCTGGCAGGGGTAGCTGCCACAGACAACGCTCATCACCTATAGAAATCCAGCCCTATAGAAGCAATTCACCCAGCCCCTTCCTACACTCCCTTTGTGTTG

TTAACTTTTTGGTTTTTCTGGTCCTAGTGAGTGCCTCCCATGCATACCTGACCAGCTCTGCCAGTGTCTGGGGTCTGGGGAACAGGGGTTGTGTGGTTTG

GTTTTTGTTTTTGTTTTTCCTTTAACATCACAGCCTCTGGCCTTGGGCAGAAGCCCTCCCCTGTGTGTGGCCCCCTCTCCTCTCTGTTCCAGTGACCTGT

GTTCCCTCGCTCTCATGTTGGGATGTTTGTGCTGCAGATAAAAAGAACAAAAAAAATAAAGTTTTTAAATACCACAAGATGGAAGAAAAACAAAAAAAAA

ATTAAAAAGATGGAATGTAGTGTTTACATTAAAGCCAGTTTTCATGATCAGTCCCATGTCATTTCTACTTGACTAGTATCTAACCCCAGACCTGTTCATG

GTTTCACTTTTAAGACAATATTTACTGAAGACCAGTCACAGCCATTTCAATAAAGGAGGCGAAAGACAAAACACAAAAAATTTAAAAATACAGAAAAAAA

AAACTTGAAAAAAGGAAAAAAGTAAAAAAAAAAAAATAAAAATAAAAAGCCCACGGGTCTTTGTAAGCCTTTCTATTCCCAACGGTGAGGTTTCTGTGAC

ACCTGACACTGCCAGCCTACTTCTCTAATGGATTCCTGTGTAGCTCAATAAAGAGAATGTTTGTCTGT
Translation
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG GAGESGKSTIVKQMK KIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYG

DKERK - UNI29681 - TDSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKY YYLDSLDRIGAGDYQPTEQDILRTRV

KTTGIVETHFTFKNLHFR RLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETT NRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGE

KIKKSPLTICFPEYPG GSNTYEDAAAYIQTQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY 

For any suggestions or comments, please send an email to unitrap@crg.es