Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031749 (St3gal2)
Chromosomal location
Chr 8: 113443822 - 113496380 (+)
Description
ST3 beta-galactoside alpha-2,3-sialyltransferase 2 Gene [Source:MGI (curated);Acc:St3gal2-001]
RefSeq_dna
NM_009179 NM_178048 
RefSeq_peptide
NP_033205.2 
UniGene
Mm.200388 Mm.413990 
MGI
MGI:99427 
Uniprot/SWISSPROT
Q11204 
Uniprot/SPTREMBL
Q3UY67 Q8BPL0 Q8BSA0 Q8BSE9 Q91WH6 
Human Ortholog
ENSG00000157350 (ST3GAL2)
Omim not available
UniTrap UNI24601
Vector Insertion
Chr 8: 113444006 - 113480657
Public Clones IST14100E5 (tigm) IST14937F11 (tigm) IST14614H7 (tigm) IST14950D4 (tigm)
IST14465C11 (tigm)
Private Clones OST213584 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25858
Vector Insertion
Chr 8: 113486263 - 113491316
Public Clones not available
Private Clones OST157317 (lexicon)
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22678
Vector Insertion
Chr 8: 113493443 - 113493564
Public Clones not available
Private Clones OST288111 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117534
Sequence
AGGGCCAGGCAAGGGCGGGACTGGCCCGAGGCTGGCGGACTGGAGAGCGGTGAAGCTAACGGGTCCAGGCGCGGGAGGCGGCGGCGGCGGCGGCGGCGGC

GGCAGCGGCGGCAGCTCTCTGCACGGGCGGAGGCGGCGGCAGGAGCGGCAAGCATGGCCCGCGCGGCGCCCAGCGCAGACTGAG - UNI24601 - GG

TCAGGCTGTGGCCGCCCGGTGCCTGACAGGTGAGGAAGAGCCTGCCAGGGGATCACTGCCAACAGGAGCCAAGGGCAGAACAGCCTCACCCTAGAAGCAG

GGGTGGGCAGGGCAGTTGCCCTGCCAAGGCCAACAGTCCCAGGAAGGAGTCTGGAGTCCCAATGAGGACCACGTAAGCTCTCCTGATCCACATGGCTTAG

AGTCTGGCACCTTGCTGAGCAGCAGCTGTTCCCAGCTCCAGACGACCCCACAGCACAGAGTAGGGGACCAGCCCCTCTGATGGGAGGCAGCAGGCCAGAC

GCTCCGCAGAAGGTCTTGGGTTTTTGTAGCCCTGACGCCCATGAAGATCACTGGTTTTCTTTCTGGCCTTGAGTCAGGCTCTTTTCCCCTGGCTAAGGAG

TTGGACCAGGACGGCCTGCAAGTGCGAAGAGGACTCGTGCATGGAATGCAGGCCCCCTGAAGCCCGTGCACCCTCTGCTGTAATCAGGGTTCCAGGGATT

CCCCACTGCAGGGGAGCAGGGGCTGCCTTAGCGTCTGCTCATGAGCCACAAGGACCCAGACTGCTCCAGACTGGACCTTTTCAAGCCACCAAAGAGGGGG

GACCCCGGAGCTGGCAGCCAGCACTCACAAGGGACTAGAGGGCTGAGATGGACTGACCTCTGCCTTGACGGGGTGGCAGAAGACGCAGAATCTTTGTGGC

CCAGCTAGTGACTGAGAGAGACCCGAGGAAGTTCTGAGCGAGAGGCTCTGGTGGCTCAGGGACGGTGGGAGGGGGGGGCTATTCCTGCTTTCCCCTTTTG

TTGAGGGAAGGTGTGGCAAGAGTCCCCTGTCACGCTTCGTGCCCCTATGCCCTTTCTACGTGCTGCCAAAACAAGCAGGCTGCGCCGTGGCTGGCCCCGC

AGCGGGCCGGGAAAGGATTGGCCACGGTGACAGCCACCCCGTGGCCAGCACGATGAAGTGCTCTCTTCGGGTGTGGTTCCTCTCTATGGCATTCCTGCTG

GTGTTCATTATGTCCCTGCTCTTCACCTACTCGCACCACAGCATGGCTACCTTGCCCTACCTGGACTCGGGGGCTCTGGGCGGCACACACCGGGTGAAGC

TGGTACCAGGCTATTCAGGACTACAGCGCCTCGGCAAGGAGGGGCTTTTGGGGAGAAATTGTGCCTGCAGTCGCTGCATGGGTGACGCCAGCACCTCTGA

ATGGTTTGACAGCCACTTTGACGGCAACATCTCACCCGTCTGGACCAGAGATAACATGAACCTCCCCCCGGATGTCCAGCGGTGGTGGATG ATGCTACA

ACCCCAATTCAAGTCACACAACACCAACGAAGTGCTGGAAAAACTGTTCCAGATCGTGCCTGGCGAGAACCCCTACCGCTTCCGGGACCCCCAACAGTGC

CGGCGCTGTGCTGTGGTCGGGAACTCAGGCAACCTTCGGGGCTCTGGCTATGGACAAGAAGTGGACAGCCACAACTTTATCATGAG - UNI25858 - 

GATGAATCAGGCACCGACTGTGGGCTTTGAGAAGGATGTTGGCAGCCGAACAACTCACCATTTCATGTACCCAGAGAGTGCCAAGAACCTGCCTGCCAAT

GTCAGCTTCGTGCTGGTCCCCTTCAAGGCCCTGGACCTAATGTGGATTGCCAGCGCCCTCTCCACAGGACAGATCCGATT CACCTATGCCCCAGTGAAG

TCCTTCCTTCGAGTGGACAAAGAGAAG - UNI22678 - GTCCAGATTTACAACCCAGCCTTCTTCAAGTACATTCACGACAGGTGGACCGAGCACCA

CGGGCGCTACCCTTCCACAGGAATGCTGGTGCTCTTCTTTGCACTACATGTGTGTGATGAGGTAGGCAGTCGGTGTTGTCTAGAGCAGAATTAGGAGAAC

CATAAACAGAGGAAACAGCCCTTTCCCCATCTTAGCTGTGGTTCCCGGGAAGTAGTTTTTGTAAACAGAAACCATGTTTTTTCATATCTGTTATTCCTAT

AAACAATATTTTTGCATTTCC
Translation
 - UNI24601 - MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYSGLQRLGKEGLLGRNCACSRCMGDASTSEWFD

SHFDGNISPVWTRDNMNLPPDVQRWWM MLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMR - UNI2

5858 - RMNQAPTVGFEKDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLMWIASALSTGQIRF FTYAPVKSFLRVDKEK - UNI22678 - V

QIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVGSRCCLEQN
Transcript ENSMUST00000034197
Sequence
AGGGCCAGGCAAGGGCGGGACTGGCCCGAGGCTGGCGGACTGGAGAGCGGTGAAGCTAACGGGTCCAGGCGCGGGAGGCGGCGGCGGCGGCGGCGGCGGC

GGCAGCGGCGGCAGCTCTCTGCACGGGCGGAGGCGGCGGCAGGAGCGGCAAGCATGGCCCGCGCGGCGCCCAGCGCAGACTGAG - UNI24601 - GG

TCAGGCTGTGGCCGCCCGGTGCCTGACAGGTGAGGAAGAGCCTGCCAGGGGATCACTGCCAACAGGAGCCAAGGGCAGAACAGCCTCACCCTAGAAGCAG

GGGTGGGCAGGGCAGTTGCCCTGCCAAGGCCAACAGTCCCAGGAAGGAGTCTGGAGTCCCAATGAGGACCACGTAAGCTCTCCTGATCCACATGGCTTAG

AGTCTGGCACCTTGCTGAGCAGCAGCTGTTCCCAGCTCCAGACGACCCCACAGCACAGAGTAGGGGACCAGCCCCTCTGATGGGAGGCAGCAGGCCAGAC

GCTCCGCAGAAGGTCTTGGGTTTTTGTAGCCCTGACGCCCATGAAGATCACTGGTTTTCTTTCTGGCCTTGAGTCAGGCTCTTTTCCCCTGGCTAAGGAG

TTGGACCAGGACGGCCTGCAAGTGCGAAGAGGACTCGTGCATGGAATGCAGGCCCCCTGAAGCCCGTGCACCCTCTGCTGTAATCAGGGTTCCAGGGATT

CCCCACTGCAGGGGAGCAGGGGCTGCCTTAGCGTCTGCTCATGAGCCACAAGGACCCAGACTGCTCCAGACTGGACCTTTTCAAGCCACCAAAGAGGGGG

GACCCCGGAGCTGGCAGCCAGCACTCACAAGGGACTAGAGGGCTGAGATGGACTGACCTCTGCCTTGACGGGGTGGCAGAAGACGCAGAATCTTTGTGGC

CCAGCTAGTGACTGAGAGAGACCCGAGGAAGTTCTGAGCGAGAGGCTCTGGTGGCTCAGGGACGGTGGGAGGGGGGGGCTATTCCTGCTTTCCCCTTTTG

TTGAGGGAAGGTGTGGCAAGAGTCCCCTGTCACGCTTCGTGCCCCTATGCCCTTTCTACGTGCTGCCAAAACAAGCAGGCTGCGCCGTGGCTGGCCCCGC

AGCGGGCCGGGAAAGGATTGGCCACGGTGACAGCCACCCCGTGGCCAGCACGATGAAGTGCTCTCTTCGGGTGTGGTTCCTCTCTATGGCATTCCTGCTG

GTGTTCATTATGTCCCTGCTCTTCACCTACTCGCACCACAGCATGGCTACCTTGCCCTACCTGGACTCGGGGGCTCTGGGCGGCACACACCGGGTGAAGC

TGGTACCAGGCTATTCAGGACTACAGCGCCTCGGCAAGGAGGGGCTTTTGGGGAGAAATTGTGCCTGCAGTCGCTGCATGGGTGACGCCAGCACCTCTGA

ATGGTTTGACAGCCACTTTGACGGCAACATCTCACCCGTCTGGACCAGAGATAACATGAACCTCCCCCCGGATGTCCAGCGGTGGTGGATG ATGCTACA

ACCCCAATTCAAGTCACACAACACCAACGAAGTGCTGGAAAAACTGTTCCAGATCGTGCCTGGCGAGAACCCCTACCGCTTCCGGGACCCCCAACAGTGC

CGGCGCTGTGCTGTGGTCGGGAACTCAGGCAACCTTCGGGGCTCTGGCTATGGACAAGAAGTGGACAGCCACAACTTTATCATGAG - UNI25858 - 

GATGAATCAGGCACCGACTGTGGGCTTTGAGAAGGATGTTGGCAGCCGAACAACTCACCATTTCATGTACCCAGAGAGTGCCAAGAACCTGCCTGCCAAT

GTCAGCTTCGTGCTGGTCCCCTTCAAGGCCCTGGACCTAATGTGGATTGCCAGCGCCCTCTCCACAGGACAGATCCGATT CACCTATGCCCCAGTGAAG

TCCTTCCTTCGAGTGGACAAAGAGAAG - UNI22678 - GTCCAGATTTACAACCCAGCCTTCTTCAAGTACATTCACGACAGGTGGACCGAGCACCA

CGGGCGCTACCCTTCCACAGGAATGCTGGTGCTCTTCTTTGCACTACATGTGTGTGATGAG - UNI22678 - GTGAACGTGTATGGGTTCGGGGCCG

ACAGTCGAGGCAACTGGCACCACTACTGGGAGAACAACCGGTACGCGGGCGAGTTCCGGAAGACAGGCGTGCATGACGCCGACTTCGAAGCCCACATCAT

CGACATGCTGGCCAAGGCCAGCAAGATCGAGGTCTACCGAGGGAACTGAGCGGCCCTGAGCGCCTTCAGAACCAGTCACTTCTGGGTCCGGCAAGCGCCG

GTTGCAGCCCACCAATCAGACTGCGCCGTCCCCAGCAACCAATCAGTGCTGCAGTTGGGAGGAGCTTCTTTCTTAGCCAATCACGCAACTCAAGGAGAAT

TTCCGGCGCCGCCGTCTCCACCAATCATGGCCTTGGGAGGCGGCGGGCCTCGACCCCCTCCCCTAAACCTGCTTTGGATAAGAATTTTGATGCTTTTTAA

GAGGCGGGTCTGGGGCTGGGCAGGAGCGCCTTGAACTGCTCATTTCCAGCTTAGGCCGGGTGGGTGAGTGAAGCCATCCAAAGAAATGTGGTTCCGGTGA

GACACTCTCCAGGGCTTTCCGTGGCGCACCAGGTAGTAGGGGGTTGAATTCACCCCCTGTTGGGTTGATCTCCCTAGGGCCTCACTAGTGTCAGGAACGG

GTAGGAAGCTTCACCGGGTCACATGCAAGGTGCTTCTCTCACATGTGCCCTCACTCCTGTCTCCTACCACCTTCTCAGCGTCTGTCCTTAGGTCCTGGGC

CTCCTCTCCAGCTCACCTGTTGATTCGGAGACAAAGTGAGACCACCCTGACTCGGCTGCTTTTGCTCTCCCACACGTGACCCGTGTCTTTAGCCCTAAGG

CGCGAGAGAGCAACACGGTTGGACAGTTGGCTGGAAAGGAGATCCCTGAGCATGTACCGTTTTCTTTCATTGTCACCCCAAAGAGGAGCAGGCAGCCTCT

TGCTTGGGGGTAGGATTTGCTTTGGACTCATGCTTTAGTTACCCTCAAGCTGCCAGGGATGGCGATCCAACCAAGATTGCTTGACAATTGTTTGCGGGGC

CTCGCGCAGATGGCTCGGAGCTTTGCTGGGGAGGAGCGGATTGGTGGCTGCCCTGCATGCCTCCTCCTGTCCGCACCTTTACCCTGCTTACTCGCCTGTT

CTAACCTACTCTCCAGCTCCAGAAGGGCCGCTCAGTCAAGAATCAGGGGTTACAACTGGAAGCTACTTGCATGACTTGGTCACAGTTGAGGTTCACTGGG

AGAAAGGGCTTCAGTGAATGTCTCAGGCCGCAGAAAACACGTCCCTGCTGCAGCGTCCACATAAATATTTCCCATTCTTAATGAGTTCACATTACCAAGC

AGCCTGGTTGGGGGACAGTCACACATAAGGGAGAGTGTTAAGAGGTTTGGGATGAGGCAACAACCCTAAAAACTAATACATGGAGAACTTTGCTCGAGTC

TGTTCCTTCCCAGTTTCAAAAGCACGGGTGGAGGAAAAAAAAAAAGGGAGGGGCGTATAGCAGAACCTCTCAGGGCTCGAACCATCGCACATAGTCACCG

TTCCAGTTTTTGCCTGTCTCATCTCTGCTCTCAAGCTGCTGTGATGAGAAACGGGAAAGCAATGCAATTATGCCAAACAGTATTGAGAAGAGTAATTTAT

TTTTCTTCCCTTTGTTTTGTTTAAATCATGAATCCCCATTCTAGAAAAGGTAGGTCCCAGAATCTACATCTTTTTCTTCTAGAGTTATTTAAACATTCAA

CTTTCCCTTCCGTTTCTTTCCCTGAATTAAAAAGAACAAAGCCCATAGAGTCACTCATCTGTTCTGAACTGCACCATCCTAGGTGTCTAAGGAGGTAAGG

GTGTTTGGGAGAACAACACAACTCTGATACCCTCTTACGGCTGAGGAGTCTAGTTCATGGGCTCTGTTCACTGAAGTCCCCCCTAAGGACTCTGAGTATT

ATGGTTTAAAAAAAAAAATCAACTTATTATGTCAGGCATGGTGGCATGTGCCCTTAATCCTAGCAGTTGAGAGGCTGAGGGGCAGGAAAAGAAGTTAAAG

GCTAGCCTCAGCTACATGGTAACTTTCAAACTAACCTGGGCTACATGAGACCTTTCTTAAGGGGGAAAAAAAGGAGCAAAAAATCTCTAGTGAGTTCTCT

CACGAGTTCTGACATTTTTCTGCTTAGCCCAATCGTGCTGTGTGGCCCACAGCTTGTTGCCAGTACAAAGTGCTATGCAAAGGAAGAGTTCTCTGGGAGA

GCTGCGGAGGGCAGATAGTGCCTCTCTGAGTTTTGCCTGTCACTAAGGATAAATGCTTAAACTTCAGTAGGGTAACTGGAAAACAGGGGGGAATGTTGGG

TCTGCACCTTAAACTACTCACTAAAATAGGTCGTATGGATCTTAGAACTAAATT
Translation
 - UNI24601 - MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYSGLQRLGKEGLLGRNCACSRCMGDASTSEWFD

SHFDGNISPVWTRDNMNLPPDVQRWWM MLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMR - UNI2

5858 - RMNQAPTVGFEKDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLMWIASALSTGQIRF FTYAPVKSFLRVDKEK - UNI22678 - V

QIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDE - UNI22678 - VNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAK

ASKIEVYRGN

For any suggestions or comments, please send an email to unitrap@crg.es