Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031750 (Il34)
Chromosomal location
Chr 8: 113265740 - 113329772 (-)
Description
interleukin 34 Gene [Source:MGI Symbol;Acc:MGI:1923777]
RefSeq_peptide
NP_083922.1 NP_001128572.1 
UniGene
Mm.77697 
MGI
MGI:1923777 
Uniprot/SWISSPROT
Q8R1R4 
Human Ortholog
ENSG00000157368 (IL34)
Omim not available
UniTrap UNI14978
Vector Insertion
Chr 8: 113279130 - 113329773
Public Clones PST10227-NR (escells) IST14591B8 (tigm) IST14506H12 (tigm) IST14835D5 (tigm)
IST14425H11 (tigm) IST14219A4 (tigm) IST13675E2 (tigm) IST12579H11 (tigm)
IST14535E10 (tigm) IST14578D6 (tigm)
Private Clones OST447311 (lexicon) OST315345 (lexicon) OST149556 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23136
Vector Insertion
Chr 8: 113273459 - 113279130
Public Clones CMHD-GT_298C10-3 (cmhd) IST14576C10 (tigm)
Private Clones OST275328 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034200
Sequence
ACTGTAGGCTGAACACACAACAGCCTGTCCCACACAGCATTTACTGCCACAGCCCCCAAGGCACCTGCTCCAGGCCTTGAGCTGCTCAAAGCTTCCGGCG

ACGGCGACTGTAGAAGCCCACATCCTGGCAGGTGAGCAG - UNI14978 - AGCTAGACTTCACGCTGAGCAGCTGCAGCCGAAGAAACCAGAGAAAG

CGCCACCCAGCCCCAGATTCCAAGAGGCCTGCCTGCTGGGGACTCCCTTCTCTTCTTCCTCCTCCTCCTCTTCCTCCTCCTGAGACCCTCAAAGTCACTG

TCTCACACCAGTTCCTGAGCTGCAATGGGACTGGCAGCCACTGCCCCCTGGCTGTCCTCCGCCCTGCCAAGCAGATAGGGCGGTAGCTACCCCAGGAGTA

TCTGCCCCCTCTCAGCCTGGACCAGCCCTTTCTGGACTTGGTGGCCACCTTTGCTGACCTAAGGCCATGTAGTCCCTGGCTCAGGCCTCTGGACACACTT

CTGGGGACAGTGCCTCTGCTCTCAGGGGGCACCCAGTGCACCACCATGCCCTGGGGACTCGCCTGGCTATACT - UNI14978 - - UNI23136 - 

GTCTTGGGATCCTACTTGACGTGGCTTTGGGAAACGAGAATTTGGAGATATGGACTCTGACCCAAGATAAGGAGTGTGACCTTACAGGCTACCTTCGGGG

CAAGCTGCAGTACAAGAACCGGCTTCAGTACATG AAACATTACTTCCCCATCAACTACAGGATTGCTGTGCCTTATGAGGGGGTACTCAGAGTGGCCAA

CATCACAAGGCTG CAGAAGGCTCACGTGAGTGAGCGAGAGCTTCGGTACCTGTGGGTCTTGGTGAGTCTCAATGCCACTGAGTCTGTGATGGATGTACT

TCTCGAGGGCCACCCGTCCTGGAAGTATCTACAGGAGGTTCAGACATTGCTGGAGAACGTACAGCGGAGCCTCATG GCCGTTGGTGTACACCTGCCGGG

ACACGTACTTGTGACCCTGCTCAGCCAGCTGCCTGGCCTCCCCAGCCCATGGGCCAGATCATTTGACACCAGCTGGGAGCTTCTGATGATGAAAG GATG

TGGAGATTGGCCCTCACGTGGAAGCTGTGTTATCTCTTCTGAGTACTCCAGGCCTAAGCCTGAAGCTGGTGCGGCCCAAAGCCTTGCTGGACAACTGCTT

CCGGGTCATGGAACTGCTGTACTGTTCTTGCT GTAAACAAAGCCCCATCTTAAAATGGCAGGACTGCGAGCTGCCCAGGCTCCATCCCCACAGTCCGGG

GTCCTTGATGCAATGTACAGCTACAAATGTGTACCCTTTGTCTCGGCAGACCCCCACCTCCCTGCCCGGATCCCCAAGCTCAAGCCATGGCTCGTTGCCC

TGAGCAATCTATGTATTGACCCTGGGTCGGGCCACTGGATGCATTTCAGAAACTGGCCTGGATCTGAGACCTTCCTGGATGGTGGGTAGGTAGCCCCTTT

AGGAAAGGCCTTCAGGGAAAGGCCTCCTGCCTTCTCTTCCACACCCAGGCTTCCTGCCTTCTGGTGGTATCACGGAGCCTCAGGGGAGGGATGTGGAGGG

GAGGGCTGGTTGCTATCCCTTACAGCCACCTCTGCTTGTGGCCCGGTCCGAAATCTGCAAACACTGTTGCCCCACAGGCGGGTGGCCAAGAACGACGGGG

TGCCTCCTAGGATCCCAGGACTTACTGGGGCTTTTCAGTTGTGCTGACTGTGGGGTGCTGGGCCGAGGACCAACCAAATGCCGTATCTTGCCATGACGAT

GCTCTTCTGGTTCCTTTTTCTATTAAATGGCCATTTATTTGG
Translation
 - UNI14978 - LPQEYLPPLSLDQPFLDLVATFADLRPCSPWLRPLDTLLGTVPLLSGGTQCTTMPWGLAWLYC - UNI14978 - - UNI2313

6 - CLGILLDVALGNENLEIWTLTQDKECDLTGYLRGKLQYKNRLQYM KHYFPINYRIAVPYEGVLRVANITRL QKAHVSERELRYLWVLVSLNATE

SVMDVLLEGHPSWKYLQEVQTLLENVQRSLM AVGVHLPGHVLVTLLSQLPGLPSPWARSFDTSWELLMMKG GCGDWPSRGSCVISSEYSRPKPEAGAA

QSLAGQLLPGHGTAVLFLL L
Transcript ENSMUST00000076846
Sequence
ACTGTAGGCTGAACACACAACAGCCTGTCCCACACAGCATTTACTGCCACAGCCCCCAAGGCACCTGCTCCAGGCCTTGAGCTGCTCAAAGCTTCCGGCG

ACGGCGACTGTAGAAGCCCACATCCTGGCAGGTGAGCAG - UNI14978 - AGCTAGACTTCACGCTGAGCAGCTGCAGCCGAAGAAACCAGAGAAAG

CGCCACCCAGCCCCAGATTCCAAGAGGCCTGCCTGCTGGGGACTCCCTTCTCTTCTTCCTCCTCCTCCTCTTCCTCCTCCTGAGACCCTCAAAGTCACTG

TCTCACACCAGTTCCTGAGCTGCAATGGGACTGGCAGCCACTGCCCCCTGGCTGTCCTCCGCCCTGCCAAGCAGATAGGGCGGTAGCTACCCCAGGAGTA

TCTGCCCCCTCTCAGCCTGGACCAGCCCTTTCTGGACTTGGTGGCCACCTTTGCTGACCTAAGGCCATGTAGTCCCTGGCTCAGGCCTCTGGACACACTT

CTGGGGACAGTGCCTCTGCTCTCAGGGGGCACCCAGTGCACCACCATGCCCTGGGGACTCGCCTGGCTATACT - UNI14978 - - UNI23136 - 

GTCTTGGGATCCTACTTGACGTGGCTTTGGGAAACGAGAATTTGGAGATATGGACTCTGACCCAAGATAAGGAGTGTGACCTTACAGGCTACCTTCGGGG

CAAGCTGCAGTACAAGAACCGGCTTCAGTACATG AAACATTACTTCCCCATCAACTACAGGATTGCTGTGCCTTATGAGGGGGTACTCAGAGTGGCCAA

CATCACAAGGCTG CAGAAGGCTCACGTGAGTGAGCGAGAGCTTCGGTACCTGTGGGTCTTGGTGAGTCTCAATGCCACTGAGTCTGTGATGGATGTACT

TCTCGAGGGCCACCCGTCCTGGAAGTATCTACAGGAGGTTCAGACATTGCTGGAGAACGTACAGCGGAGCCTCATG GATGTGGAGATTGGCCCTCACGT

GGAAGCTGTGTTATCTCTTCTGAGTACTCCAGGCCTAAGCCTGAAGCTGGTGCGGCCCAAAGCCTTGCTGGACAACTGCTTCCGGGTCATGGAACTGCTG

TACTGTTCTTGCT GTAAACAAAGCCCCATCTTAAAATGGCAGGACTGCGAGCTGCCCAGGCTCCATCCCCACAGTCCGGGGTCCTTGATGCAATGTACA

GCTACAAATGTGTACCCTTTGTCTCGGCAGACCCCCACCTCCCTGCCCGGATCCCCAAGCTCAAGCCATGGCTCGTTGCCCTGAGCAATCTATGTATTGA

CCCTGGGTCGGGCCACTGGATGCATTTCAGAAACTGGCCTGGATCTGAGACCTTCCTGGATGGTGGGTAGGTAGCCCCTTTAGGAAAGGCCTTCAGGGAA

AGGCCTCCTGCCTTCTCTTCCACACCCAGGCTTCCTGCCTTCTGGTGGTATCACGGAGCCTCAGGGGAGGGATGTGGAGGGGAGGGCTGGTTGCTATCCC

TTACAGCCACCTCTGCTTGTGGCCCGGTCCGAAATCTGCAAACACTGTTGCCCCACAGGCGGGTGGCCAAGAACGACGGGGTGCCTCCTAGGATCCCAGG

ACTTACTGGGGCTTTTCAGTTGTGCTGACTGTGGGGTGCTGGGCCGAGGACCAACCAAATGCCGTATCTTGCCATGACGATGCTCTTCTGGTTCCTTTTT

CTATTAAATGGCCATTTATTTGG
Translation
 - UNI14978 - MPWGLAWLYC - UNI14978 - - UNI23136 - CLGILLDVALGNENLEIWTLTQDKECDLTGYLRGKLQYKNRLQYM KHY

FPINYRIAVPYEGVLRVANITRL QKAHVSERELRYLWVLVSLNATESVMDVLLEGHPSWKYLQEVQTLLENVQRSLM DVEIGPHVEAVLSLLSTPGLS

LKLVRPKALLDNCFRVMELLYCSCC CKQSPILKWQDCELPRLHPHSPGSLMQCTATNVYPLSRQTPTSLPGSPSSSHGSLP

For any suggestions or comments, please send an email to unitrap@crg.es