Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031774 (2310065K24Rik)
Chromosomal location
Chr 8: 97098843 - 97125579 (-)
Description
RIKEN cDNA 2310065K24 gene Gene [Source:MGI Symbol;Acc:MGI:1919637]
RefSeq_dna
NM_028221 
RefSeq_peptide
NP_082497.2 
UniGene
Mm.250425 
MGI
MGI:1919637 
Uniprot/SWISSPROT
Q91WE2 
Uniprot/SPTREMBL
Q05CB0 Q3U9X3 
Human Ortholog
ENSG00000172775 (AC009090.12)
Omim not available
UniTrap UNI12688
Vector Insertion
Chr 8: 97113308 - 97125396
Public Clones (sanger) A003F08 (ggtc)
Private Clones OST375483 (lexicon) OST179153 (lexicon) OST146787 (lexicon) OST108259 (lexicon)
OST95945 (lexicon) OST77962 (lexicon) OST68874 (lexicon) OST62242 (lexicon)
OST45496 (lexicon) OST38083 (lexicon) OST34038 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22255
Vector Insertion
Chr 8: 97112814 - 97113210
Public Clones not available
Private Clones OST302200 (lexicon) OST217711 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25246
Vector Insertion
Chr 8: 97106915 - 97111223
Public Clones not available
Private Clones OST190458 (lexicon)
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034226
Sequence
AAGGAACAGGAAGCCCCGAAGGGTCAAAAGGAATACAATAGCGAAGTGTGTTTTCTTCCTTTAAGCCGTCGTTCTTTTCTTGGTTTCTTTTCTAGTTTTT

TAAGAGCGAGAGTGGCCTTGGCGGCGACGGTTTACGGTAGGCGCCGCGGAGGTGAGGGCGGCTCGCCTCCCGCGCTCTCGTAG - UNI12688 - ATC

TGCCACCTCCCTCCTTCATAGACGGGACTTGACTGCTAAAGCGCCTTGAGTACCTGAGAGTCTCCATTAGAATCTGCTTTGGAAGCAAGAACAG - UNI

22255 - ACTGTACCATTATGGATGGAGAGGACGATAGTAACCTTGTCATCAAAAAGAGGTTTGTGTCTGAGGCAGAGCTAGATGAGCGGCGCAAAAGG

AGGCAAGAAGAATGGGAGAAAGTGCGAAAACCAGAAGACCCAAAAG AATGTCCAGAGGAGGCGTATGACCCTCGGTCTCTGTACGAACGGCTGCAGGAA

CAGAAAGACAGGAAGCAGCAGGAGTATGAGGAGCAATTCAAATTCA AAAACATGGTAAGAGGGTTAGACGAAGATGAGACCAACTTCCTTGATGAGGTT

TCTCGGCAGCAGGAGCTGATAGAGAAGCAGCGGCGAGAAGAAGAACTAGAGGAACTGAAGGAGTACAGA - UNI25246 - AGTAATCTCAACAAGGT

TGGAATTTCTGCAGAAAATAAAGAAGTAGAGAAGAAGCTGGCCGTGAAACCCATAGAAACCAAGAACAAGTTCTCCCAGGCAAAGCTGTTGGCAGGAGCT

GTGAAACATAAGAG CTCAGAGAGTGGCAATAGTGTGAAGAGACTGAAACCAGACCCCGACCCAGATGACAAGGCTCAAG AGGCCCCGTCCTGCATGTC

TCTTGGAAGCTCTTCTCTGAGCGGACCTCCCTCCATCCACTGCCCGTCGGCTGCTGTGTGCATCGGCATCCTCCCTGGCTTGGGCGCCTACTCTGGGAGC

AGTGACTCCGAATCCAGTTCAGACAGTGAAGGCACCATCAATGCTACAGGGAAGATCGTCTCCTCCATCTTCCGAACCAACACCTTCCTCGAGGCACCCT

AGCTCCTGATATTACCACAGGGAGCATCTCAGAGGGTTGGATGCCAGTTCTGCCTCGGCATCACCTCCCTCAGAAAACTTACTCACCTGCTTCCTGTGCA

CATGTGACATTTTAACCTAACTCAGAAATGTGTCTCAGTCCACTTGTGGCTCAAACTCGGCTTGATTTCTCTTTATACTCCTGTGCAGATGACCAAACCT

GTCCCATTGATATGAGGAGTCGGGGTTCAGGCTTGTCTCAGAAATGTCACGGACAGTGCAAGGACAGGCAGCAGCTGGCCTGCCAGGGTTTGGTGTACCT

TGTTGCTGTCTTGTTTATCTCCTTACCTAGCAGCACAGGAAGCAAGGGCAGCGTTAGCTTCATATGTTGTTGTAGATGAATGGGTTTCTTGGTTCTACCA

TGTTGTGTGTGGGCATAGAGAAAGGGGCTGACCAGCTGGTGACATGGAGCTGTCCCCTAGAACTAACCCTTCCTGGGTGTTGTGTGACTTAAGTAAAAAT

CTCAAGCCTCACCCACAAGGCTGTGAGCCAACGACAGCCCTTGAGCAGAGACTCTTCCATGTCCTCCCCTCTCCATCCAGCCTGAGGAGGTAGGAAGGAG

CTGACCACGAGAACATGACCATCCTCTGCCCACCTTCTCTCTCTGAAAAAATGTTTTGATTTTGTTTTTGAAATAAAAGATTTAGTTTAAGATTCT
Translation
 - UNI12688 -  - UNI22255 - MDGEDDSNLVIKKRFVSEAELDERRKRRQEEWEKVRKPEDPKE ECPEEAYDPRSLYERLQEQKDRKQQEYE

EQFKFK KNMVRGLDEDETNFLDEVSRQQELIEKQRREEELEELKEYR - UNI25246 - SNLNKVGISAENKEVEKKLAVKPIETKNKFSQAKLLAG

AVKHKS SSESGNSVKRLKPDPDPDDKAQE EAPSCMSLGSSSLSGPPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTF

LEAP

For any suggestions or comments, please send an email to unitrap@crg.es