Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031783 (Polr2c)
Chromosomal location
Chr 8: 97381421 - 97394589 (+)
Description
polymerase (RNA) II (DNA directed) polypeptide C Gene [Source:MGI Symbol;Acc:MGI:109299]
RefSeq_dna
NM_009090 
RefSeq_peptide
NP_033116.2 
UniGene
Mm.459352 Mm.292492 
MGI
MGI:109299 
Uniprot/SWISSPROT
P97760 
Uniprot/SPTREMBL
Q99M46 Q9DB22 Q3UUX3 
Human Ortholog
ENSG00000102978 (POLR2C)
Omim not available
UniTrap UNI6196
Vector Insertion
Chr 8: 97381697 - 97384143
Public Clones CSG212 (baygenomics) IST14631F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16652
Vector Insertion
Chr 8: 97384213 - 97384343
Public Clones not available
Private Clones OST456334 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9310
Vector Insertion
Chr 8: 97384397 - 97385610
Public Clones XH291 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109521
Sequence
GTGCGGCTGGCGCGGGAGCCTGGCGGAGGGTCGCGATGCCGTACGCCAACCAGCCAACAGTGCGGATCACGGAACTCACCGAAGAGAACGTCAAGTTCAT

TATCGAGAACACGGACCTGGC GGTGGCCAATTCCATTCGGAGGGTCTTCATCGCAGAGGTGCCCATAATAG - UNI6196 - CCATCGACTGGGTTC

AGATTGACGCCAACTCCTCGGTCCTTCATGATGAATTCATCGCGCACAGGCTTG - UNI16652 - GTTTAATCCCCCTCACTAGTGATGACATTGTG

GACAAGCTGCAGTACTCCCGG - UNI9310 - GACTGCACATGTGAAGAGTTCTGCCCTGAGTGTTCTGTGGAGTTCACTCTCGATGTGAGGTGCAAT

GAAGACCAGACGCGCCATGTCACCTCCCGAGATCTCATCTCCAACAGCCCCCGGGTTATTCCG GTGACATCTCGGAACCGGGATAACGACCCTAATGAC

TATGTGGAGCAGGATG ACATCCTTATTGTCAAGCTGAGGAAGGGGCAGGAGCTGAGACTTCGAGCCTATGCCAAGAAGGGCTTTGGCAAGGAACATGCC

AAGTGGAACCCTACTGCGGGGGTAGCTTTTGAATACGATCCAGACAACGCACTTAGGCATACAGTGTATCCCAAGCCTGAGGAATG GCCCAAGAGTGAG

TATTCCGAGCTGGATGAGGATGAGTCGCAGGCTCCCTACGACCCCAACGGCAAGCCAGAGAG GTTTTACTACAATGTGGAGTCGTGTGGCTCACTGCGC

CCTGAAACCATTGTCCTCTCAGCCCTGTCGGGGCTAAAGAAGAAGCTGAGTGATTTACAGACTCAGTTAAGCCATGAGATCCAGAGTGACGTGCTCACCA

TAAACTAGCCACGGCTCGCCTGCCTCCGAAGACTAGGTTCACGGTGGCTGGACTTCAGGCCTCGGGAGCCCTTGTAGTTTCTGGGCTATGCACTGCACAG

TCTGCCCCCTGGAAGGCCATCGGGGAGATGGCCAGGGTCCCACTGGTGTTAGACATGGCGGGTTTTATTAAGCGTTGAGCATCCCGGGCCCTACTGTAGT

GGTTTTCAGGCAGCATGGGGGGAAACACACACCAGCACGGAAAAGAAGGAATATTTATTGATCAACAGTAGTTGTCTTTTTAAAAGTTTTTATTTTTGGC

AATAAAGAGCACAACATAATCTC
Translation
MPYANQPTVRITELTEENVKFIIENTDLA AVANSIRRVFIAEVPIIA - UNI6196 - AIDWVQIDANSSVLHDEFIAHRLG - UNI16652 - G

LIPLTSDDIVDKLQYSR - UNI9310 - DCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIP VTSRNRDNDPNDYVEQDD DILIVKL

RKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEW WPKSEYSELDEDESQAPYDPNGKPER RFYYNVESCGSLRPETIVLSAL

SGLKKKLSDLQTQLSHEIQSDVLTIN
Transcript ENSMUST00000034235
Sequence
GTGCGGCTGGCGCGGGAGCCTGGCGGAGGGTCGCGATGCCGTACGCCAACCAGCCAACAGTGCGGATCACGGAACTCACCGAAGAGAACGTCAAGTTCAT

TATCGAGAACACGGACCTGGC GGTGGCCAATTCCATTCGGAGGGTCTTCATCGCAGAGGTGCCCATAATAG - UNI6196 - CCATCGACTGGGTTC

AGATTGACGCCAACTCCTCGGTCCTTCATGATGAATTCATCGCGCACAGGCTTG - UNI16652 - GTTTAATCCCCCTCACTAGTGATGACATTGTG

GACAAGCTGCAGTACTCCCGG - UNI9310 - GACTGCACATGTGAAGAGTTCTGCCCTGAGTGTTCTGTGGAGTTCACTCTCGATGTGAGGTGCAAT

GAAGACCAGACGCGCCATGTCACCTCCCGAGATCTCATCTCCAACAGCCCCCGGGTTATTCCG GTGACATCTCGGAACCGGGATAACGACCCTAATGAC

TATGTGGAGCAGGATG ACATCCTTATTGTCAAGCTGAGGAAGGGGCAGGAGCTGAGACTTCGAGCCTATGCCAAGAAGGGCTTTGGCAAGGAACATGCC

AAGTGGAACCCTACTGCGGGGGTAGCTTTTGAATACGATCCAGACAACGCACTTAGGCATACAGTGTATCCCAAGCCTGAGGAATG GCCCAAGAGTGAG

TATTCCGAGCTGGATGAGGATGAGTCGCAGGCTCCCTACGACCCCAACGGCAAGCCAGAGAG GTTGGGGGATCTAGGACCCAGGCCCCTAACCTTGGGG

CAGCCTCGGAGGCACACGGACTTCTCATCAGGATACTTCTCCAGCCGCTGGGGCCCCTTGCTGGAAGATTTCCGGAACACCAGCCAGCACCTCCG CCTC

ACTCTCCAGTCACTCCCGCTACCCGGTGGTGGCTGCCACCTCTGCTGCTGCCAGTGCCTCTGCCGCTGTGGCCACAACTTCAACAATAGCGGGGATGCCT

CTGCCAGCCTGTCAGCTACCACTACTGGTCCAGTGGCCGGGATGCCAGCCAGCCCAGCTGGGGCGAGAGATGCAGTAG
Translation
MPYANQPTVRITELTEENVKFIIENTDLA AVANSIRRVFIAEVPIIA - UNI6196 - AIDWVQIDANSSVLHDEFIAHRLG - UNI16652 - G

LIPLTSDDIVDKLQYSR - UNI9310 - DCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIP VTSRNRDNDPNDYVEQDD DILIVKL

RKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEW WPKSEYSELDEDESQAPYDPNGKPER RLGDLGPRPLTLGQPRRHTDFS

SGYFSSRWGPLLEDFRNTSQHLR RLTLQSLPLPGGGCHLCCCQCLCRCGHNFNN

For any suggestions or comments, please send an email to unitrap@crg.es