Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031786 (Ccdc135)
Chromosomal location
Chr 8: 97579003 - 97602040 (+)
Description
coiled-coil domain containing 135 Gene [Source:MGI Symbol;Acc:MGI:2685616]
RefSeq_dna
NM_001042715 
RefSeq_peptide
NP_001036180.2 
UniGene
Mm.277112 
MGI
MGI:2685616 
Uniprot/SWISSPROT
Q6V3W6 
Human Ortholog
ENSG00000159625 (CCDC135)
Omim not available
UniTrap UNI33609
Vector Insertion
Chr 8: 97592081 - 97594302
Public Clones IST12712A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000058479
Sequence
GTTACCATAGAGACAAGTAACAGTAAGGCTGTTCTTGGAGG CTGTCAGGATGGAGGTCCTGAGAGAGAAAGTGGAGGAGGAGGAGGAGGCTGAGCGTGA

AGAAGCAGCCGAGAGGGCCGAACGGACTGAGAAGCTGGAGAGGGTGACAAAGTCCGCCGAAGTGAGCAGAGAGGGGACCATCCTGAGCCAGGATGAGCTT

CGAGACCTGGAGGGGAAGCTGATGGCCATCGAGATCCCTACCCAAGCTGATCACTC GGTCATAAGCCAGGCCCCTGTTGATGTCACCAAGCTGCCTCCT

TCCTATACCACCAACTCATTGAAGGAGGAGCACCTGCTGCTGGTGGCAGACAACTTCTCCCGCCAGTACAGCCACCTGTGTCCAGACCGCGTGCCTCTCT

TCTTGCACCCGTTAAATGAGTGCAATGTGCCT AAGTTCGTGAGCACCACCCTGAGGCCCACACTGATGCCCTACCCTGAACTCTACAACTGGGACAGCT

GCGCCCAGTTTGTATCTGACTTCCTCACCATGGTCCCACTGGTTGATCCCCTCAAGCCG CCCACGCACTTATATTCCTCGACCACCGTGCTCAAGTGCC

AGAAGGGAAACTGCTTTGACTTCAGCACCCTGCTCTGCTCCATGTTGATTGGCTCCGGCTATGATGCCTACTGCGTCAATGGCTATGGCTCACTGGACCT

GTGCCTCATGGACCTGACAAGGGAAGTGTGTCCGCTCACTGTGAAGGCCAAAGAG ATAGTCAAGAAGAAAGAGAAGACGGTGCCTAAGAAATACTCCAT

CAAGCCGCCCCGGGACCTGACCAGCAAGTTTGAGCAGGAGCAAGAGGAGAAGAGAATACAGGAGATCAAGGATCTAGAACAAAGGCGACTTAAGGAAGAG

GAAGATCGCATCCTG GAGGCAGAGAAAGCGAAGCCCGACCCCCTGCATGGCCTGCGGGTACACTCCTGGGTCCTGGTGCTGGCAGGAAAGCGAGAGGTG

CCTGAGAGCTTCTTCATCGACCCTCTGACTGCACGCAGCTACAGTACCAAGGATGAGCACTTCCTGGGCATTGAGAGCCTCTGGAACCACAAGAACTACT

GGATCAACATGCAGGATTGCTGGAACTGCTGCAAG GACTTGATCTTCGACCTGGGAGACCCTGTAAGATGGGAGTACATGCTCTTGGGGACCGATAAGC

CTCACCTGTCCTTGACTGAGGAGGATGAAGAAGGGCTGGATGATGATGATGATGATGTGGAAGACCTG - UNI33608 - GGCAAAGAAGAGGAGGAT

AAGAGCTTTGACATGCCGTCTTCGTGGGTCTCCCAGATTGAGATCACCCCAGAAG AGTTTGAGACCCGTTGTCCCAGTGGGAAGAAAGTGATACAGTAC

AAGAAGGCACAGCTGGAGAAGTGGTCCCCATACCTCAACAACAACGGCCTGGTGTGTCGCCTCACCACCTACGAGGACCAACAGT GCACAAAGGTTCTA

GAGATAAAGGAGTGGTACCAGAACCGGGAGGATATGCTAGAGCTGAAGCACATCAACAAGACCACAGGCCTGCACGTGGACTACTTCAAGCCAGGCCATC

CCCAAGCTCTGTGTG TGCACTCATACAAGTCTATGCTACCTGAGATGGACCGCGTCATGGAGTTCTATAAAAAAATCCGTGTGGATGGCCTGGTGAAGC

GGGAGGAGACGCCCATGACAATGACCGAGTACTATGAAGGGCGCTCCGACTTCCTTGCCTATCGGCACGTCAATTTTGGACCCAGAGTCAAGAAGCTCAG

CCAGAGCAGCGTGGAGTCGAACCCAAGGCCCATGGTG AAAATCACAGAGCGGTTCTCCCGCAATCCAGAGAAGCCCGCGGATGAGGACGTGGCAGAGCG

TTTGTTTCTGATAGTGGAAGAGCGCATCCAGCTTCGCTACCATTGCCGCGACGACTACATCACCGCATCCAAGCGAGAGTTCCTGCGGCGCATGGAGGTC

GACAGCAAGGGAAACAAGATCATCATGACACCAGAAATGTGCATCAGCTACGAG GTAGAGCCGATGGAGCACACTAAGAAACTCCTCTACCAGTACGAG

ACCATGAATCAGCTGAAGAACGAAGAAAAGCTGTCCCGACATCAGGCCTGGGAGTCGGAGCTGGAG GTGCTGGAGATTTTGAAGCTCCGTGAAGAGGAG

GAGGAGGCACACACGCTGACCATCTCCATCTACGACACCAAGCGCAACGAGAAGAGCAAAGAGTATCGGGAGGCCATG GAGCGCGTCTTGCATGAGGAG

CACCTGCGGCAGGTGGAGGCCCAGCTGGACTACCTGGCCCCATTCCTGGCCCAGCTCCCTCCAGGCGAGAAGCTAACCCGTTGGCAGGCGGTGCGTCTCA

AGGACGAGTGTCTCAGCGACTTCAAGCAGCGGCTCATCGACAAGGCTAACCTCATCCAGGCTCGCTTTGAGAAG GAGACCCAGGAGCTGCAGAAGAAGC

AGCAATGGTACCAGGAGAACCAGGTAACCCTGACGCCGGAGGATGAAAACCTGTACCTGAGCTACTGTTCTCAGGCCATGTTCCGCATCCGAATCTTGGA

ACAGCGGCTCAATCG GCACAAAGAGCTGGCTCCACTGAAGTACCTGGCGCTGGAGGAAAAGCTCTACAAAGACCCACGCTTAATAGACTTCGTAAAAGT

CTTTGTTTGATGGCCCCTCCTGGAACTACGGCAGACCCTGCCAGAGAATGGAGTCTCTCCCTTCTCCCCAACCACTATGATCCTATACTAGCCTCGCTGC

CACACTACCTCCCTATCCCTCATAGCCTCCCTCAAATAAATGCATTTCCTGTTTGCCATTT
Translation
 MEVLREKVEEEEEAEREEAAERAERTEKLERVTKSAEVSREGTILSQDELRDLEGKLMAIEIPTQADHS SVISQAPVDVTKLPPSYTTNSLKEEHLLL

VADNFSRQYSHLCPDRVPLFLHPLNECNVP KFVSTTLRPTLMPYPELYNWDSCAQFVSDFLTMVPLVDPLKP PTHLYSSTTVLKCQKGNCFDFSTLLC

SMLIGSGYDAYCVNGYGSLDLCLMDLTREVCPLTVKAKE IVKKKEKTVPKKYSIKPPRDLTSKFEQEQEEKRIQEIKDLEQRRLKEEEDRIL EAEKAK

PDPLHGLRVHSWVLVLAGKREVPESFFIDPLTARSYSTKDEHFLGIESLWNHKNYWINMQDCWNCCK DLIFDLGDPVRWEYMLLGTDKPHLSLTEEDEE

GLDDDDDDVEDL - UNI33608 - GKEEEDKSFDMPSSWVSQIEITPEE EFETRCPSGKKVIQYKKAQLEKWSPYLNNNGLVCRLTTYEDQQC CTK

VLEIKEWYQNREDMLELKHINKTTGLHVDYFKPGHPQALCV VHSYKSMLPEMDRVMEFYKKIRVDGLVKREETPMTMTEYYEGRSDFLAYRHVNFGPRV

KKLSQSSVESNPRPMV KITERFSRNPEKPADEDVAERLFLIVEERIQLRYHCRDDYITASKREFLRRMEVDSKGNKIIMTPEMCISYE VEPMEHTKKL

LYQYETMNQLKNEEKLSRHQAWESELE VLEILKLREEEEEAHTLTISIYDTKRNEKSKEYREAM ERVLHEEHLRQVEAQLDYLAPFLAQLPPGEKLTR

WQAVRLKDECLSDFKQRLIDKANLIQARFEK ETQELQKKQQWYQENQVTLTPEDENLYLSYCSQAMFRIRILEQRLNR RHKELAPLKYLALEEKLYKD

PRLIDFVKVFV

For any suggestions or comments, please send an email to unitrap@crg.es