Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031787 (Katnb1)
Chromosomal location
Chr 8: 97605189 - 97622956 (+)
Description
katanin p80 (WD40-containing) subunit B 1 Gene [Source:MGI Symbol;Acc:MGI:1921437]
RefSeq_dna
NM_028805 
RefSeq_peptide
NP_083081.2 
UniGene
Mm.28382 
MGI
MGI:1921437 
Uniprot/SWISSPROT
Q8BG40 
Human Ortholog
ENSG00000140854 (KATNB1)
Omim not available
UniTrap UNI6504
Vector Insertion
Chr 8: 97606794 - 97611187
Public Clones YHC357 (baygenomics) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1283
Vector Insertion
Chr 8: 97613978 - 97617415
Public Clones DC0817 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034239
Sequence
AGAGCTACAGCTGCAG CCCAGTGTTGAGCTGAGATGGTCCAAGCCTGACATTCCATGATCTGGGATCCCGACCTATGTGTCCAGGCTGCTGCTTGATAG

CGGATGATCTAAACCACCAGGCAGTCCTGGGCCAGGAGAGGCGGACTCTCTGCCTGGATGTGTGGGAACTCCCTGCCAACTTGATTGTCGGATCTGGGGG

GGATCCACCCCCACCCCACAGAGAAAGCACAATCTGTTTTGTGGGTGGGGTCTCAGGCGCCACCCCCTGAAGCATGGCCACCCCTGTGGTCACCAAGACA

GCCTGGAAGTTGC - UNI6504 - AAGAGATCGTCGCCCATGCCAGCAATGTGTCCTCCTTGGTGCTGGGCAAGGCCTCAGGGCGGCTGCTGGCCACT

GGTGGGGATGACTGCCGAGTCAACCTGTGGTCCATAAACAAGCCTAACTGCATCATG AGCCTGACAGGTCACACGTCCCCTGTGGAGAGTGTCCGTCTC

AACACTCCTGAGGAGCTCATCGTAGCTGGTTCCCAGTCGGGCTCCATCCGCGTCTGGGACCTGGAAGCTGCTAAAA - UNI1283 - TTCTTCGAACA

CTCATGGGCCACAAAGCCAACATCTGCAGCCTGGATTTCCACCCCTATGGTGAATTTGTGGCCTCAGGCTCCCAGGACACAAACATTAAG CTCTGGGAC

ATCAGGAGGAAAGGCTGTGTCTTCCGATATAGG GGGCACAGCCAGGCTGTGCGGTGTCTCCGGTTCAGCCCTGATGGGAAGTGGCTGGCGTCGGCAGCA

GATGACCACACAGTGAAG CTTTGGGATCTGACGGCTGGCAAGATGATGTCCGAGTTCCCGGGTCATACAGGGCCTGTCAATGTGGTGGAGTTTCACCCC

AATGAATATCTCCTAGCTTCTGGCAGCTCCGACAG GACAATCCGCTTCTGGGACCTGGAGAAGTTCCAGGTGGTGAGCTGCATTGAAGGGGAGCCCGGG

CCCGTCAG GAGTGTCCTCTTCAACCCCGACGGCTGCTGCTTGTACAGCGGCTGCCAGGACTCGCTGCGTGTCTACGGCTGGGAACCTGAGCGCTGCTTT

GATGTGGTCCTTGTCAACTGGGGCAAGGTGGCTGACCTGGCCATCTGCAATGACCAGCTG ATAGGTGTGGCTTTCTCCCAGAGTAATGTCTCCTCTTAT

GTGGTGGACCTGACGAGAGTCACCAGGACGGGAACTGTGACCCAGGACCCTGTGCAGGCTAACCAGCCTCTGACACAACAGACCCCTAACCCTGGTGTCT

CCCTCCGCCGCATCTATGAGCGGCCCAGCACGACATGCAGCAAGCCTCAGAG GGTAAAGCACAACTCAGAGAGCGAGCGGCGCAGCCCCAGCAGCGAAG

ATGACAGGGACGAGCGAGAGTCCCGGGCGGAGATCCAGAACGCGGAGGACTACAATGAGATTTTCCAGCCCAAGAACAGCATCA GTCGGACACCACCCC

GGAGAAGTGAGCCCTTCCCAGCACCCCCAGAAGATG ATGCAGCCACAGTGAAGGAGGTCTCAAAACCCAGCCCAGCCATGGATGTGCAGTTGCCGCAGT

TGCCGGTGCCAAAT CTCGAGGTCCCAGCACGACCGTCAGTCATGACTTCCACTCCTGCACCCAAGGGTGAACCTGACATCATCCCTGCCACACGGAATG

AGCCCATTGGCTTAAAGGCCTCGGACTTCTTGCCC GCCGTGAAGGTCCCCCAGCAGGCAGAGCTGGTGGACGAGGATGCCATGTCGCAGATACGCAAAG

GCCACGACACCATGTTTGTGGTGCTCACCAGCCGCCACAAGAACCTGGACACTGTCCGAGCTGTATGGACTACAGGAGATATCAAG ACATCAGTGGACT

CTGCAGTGGCCATCAATGACCTGTCTGTGGTAGTGGACCTCCTGAACATTGTCAATCAGAAAGC CTCCCTGTGGAAGCTGGACCTGTGCACCACAGTGC

TGCCCCAGATCGAGAAACTGCTGCAGAGCAAGTATGAGAG CTATGTCCAGACCGGGTGCACCTCCCTGAAGCTGATCCTGCAGCGGTTCCTACCCCTCA

TCACTGACATTTTGGCAGCCCCGCCCTCTGTGGGTGTGGACATCAGCCGAGAGGAGAG GTTGCACAAGTGTCGACTCTGCTTCAAACAACTCAAGAGCA

TCAGTGGCCTCGTCAAGAGCAAGTCGGGTTTGAGTGGCCGCCATGGCAGTGCCTTCCGTGAGCTGCACCTACTCATGGCCAGTTTGGACTGAGGAGCACA

CGGTGGGAGCACCCGCAGCCCTCACACATACATACTTGCTGTATGCCTGTGGCCCACGAGCCTCAGCCTGGCCTCCATTCCTGCCCTGCTGGCCATCCTG

GAGGCATGGTTGCCAGCCTGCTGACCACCTCCTCGGTTGTGGACTAAGCTCCTCTCCGGCAGCAGCTGCAGTCTTGCACAGCCCTTACTGCTCAGGGCAA

CTCCAGCCTCGGGGCTGCTGCTGTAAATTATCAGGCAGATTTATTAAATTTATAACTGTTCC
Translation
 MATPVVTKTAWKLQ - UNI6504 - QEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIM SLTGHTSPVESVRLNTPEELIVAGSQS

GSIRVWDLEAAKI - UNI1283 - ILRTLMGHKANICSLDFHPYGEFVASGSQDTNIK LWDIRRKGCVFRYR GHSQAVRCLRFSPDGKWLASAADD

HTVK LWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDR RTIRFWDLEKFQVVSCIEGEPGPVR RSVLFNPDGCCLYSGCQDSLRVYGWEPER

CFDVVLVNWGKVADLAICNDQL IGVAFSQSNVSSYVVDLTRVTRTGTVTQDPVQANQPLTQQTPNPGVSLRRIYERPSTTCSKPQR RVKHNSESERRS

PSSEDDRDERESRAEIQNAEDYNEIFQPKNSIS SRTPPRRSEPFPAPPEDD DAATVKEVSKPSPAMDVQLPQLPVPN LEVPARPSVMTSTPAPKGEP

DIIPATRNEPIGLKASDFLP AVKVPQQAELVDEDAMSQIRKGHDTMFVVLTSRHKNLDTVRAVWTTGDIK TSVDSAVAINDLSVVVDLLNIVNQKA A

SLWKLDLCTTVLPQIEKLLQSKYES SYVQTGCTSLKLILQRFLPLITDILAAPPSVGVDISREER RLHKCRLCFKQLKSISGLVKSKSGLSGRHGSAF

RELHLLMASLD

For any suggestions or comments, please send an email to unitrap@crg.es