Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031788 (Kifc3)
Chromosomal location
Chr 8: 97623733 - 97666449 (-)
Description
kinesin family member C3 Gene [Source:MGI Symbol;Acc:MGI:109202]
RefSeq_peptide
NP_034761.2 
MGI
MGI:109202 
Uniprot/SWISSPROT
O35231 
Human Ortholog
ENSG00000140859 (KIFC3)
Omim not available
UniTrap UNI16704
Vector Insertion
Chr 8: 97662020 - 97666331
Public Clones 3SD083H05 (ggtc) IST11062G7 (tigm)
Private Clones OST455743 (lexicon) OST61283 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27686
Vector Insertion
Chr 8: 97658760 - 97661814
Public Clones (egtc) IST14921F3 (tigm) IST14865F3 (tigm)
Private Clones OST53654 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20007
Vector Insertion
Chr 8: 97634660 - 97658616
Public Clones IST10765C6 (tigm)
Private Clones OST375190 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15467
Vector Insertion
Chr 8: 97624546 - 97625418
Public Clones PST8037-NR (escells) PST142-2 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034240
Sequence
GAGGCAGCGGCGGCGGCGTGGAGCTGCCTCGCGCGGGCGGGCGGGCCGGAGCCGGCCGGAGCGGGCCGAGCCCGGGGCGCTGCGGTGGCGGCGCTGGGAT

CCTGTCTCCGCTAGGCCG - UNI16704 - CTTGCCCGGCACCCAGAAGAGGTTACTGAGCCCCGGGCCATGGTCCCCTCTCGCAGGACGTGGAACTT

GGGAGCCACGCCTTCACTGCGAGGCCTGTGGAGAGTGGGCCGGGTCCAGGAGCCCAAGCCCGGGATGGCTCGCCCCGCCCCAGCCAGCCCAGCCGCCCGC

CCTTTCCCACACACCGGCCAGGGGAGGTTGAGAACTG - UNI27686 - GGCGTGGAAAAGATATTCTACCCAGTGGCGAGGAAGACTCCACTTCTCG

GACTGCAGCTCGCCCGTCTCTTGCACAGTGTCGAGCCCTCAGCGTGGACTGGCCTGGCCCTAGGAGTCCCCATAGACTCTACCTGACAGTGCAG - UNI

20007 - GTGGAGAATCTAAAGGAAAAGCTCATTAGCCAGGCCCAGGAAGTGAGCCGACTGCGATCAGAACTG GGAGGCACGGACGCGGAGAAGCACA

GGGACAGACTGATGGTGGAGAATGAGCAGCTGAGGCAGGAGCTGAGGCGCTGTGAGGTCGAACTGCAGGAGCTTCGGGCCCAGCCGGTGGTGCCCTGCGA

GGGCTGTGAGCACAGCCAG GAGAGCAGCCAGCTCCGTGACAAGCTGTCCCAGCTGCAGTTGGAAGTGGCTGAGAACAAAGGCATGCTGTCGGAACTGAA

CCTGGAGGTGCAGCAGAAAACGGACCGGCTGGCAGAGGTAGAGCTGCGCCTCAAGGACTGTCTGGCTGAGAAAGCCCAGGAGGAGGAACGGCTCAGCCGG

CGCCTGCGTGACAGCCATGAGACTATCGCCAGTCTGAGGGCCCAGTCCCCACCTGTTAAG TATGTCATCAAGACAGTGGAGGTAGAGTCTTCCAAGACC

AAGCAGGCCCTCAGCGAGTCCCAGACCCGGAACCAGCACCTGCAGGAGCAAGTGGCCATGCAGCGGCAGGTGCTGAAGGAGATGGAGCAGCAGCTACAGA

ACTCCCACCAGCTGACAGTCCAGTTGCGGGCTCAG ATTGCCATGTATGAGGCAGAGCTGGAGCGGGCACACGGGCAGATGCTGGAGGAGATGCAGTCCT

TGGAGGAGGATAAGAACCGGGCCATTGAGGAGGCCTTTGCACGGGCCCAGGTGGAGATGAAGGCAGTACACGAGAACCTGGCAG GTGTCAGGACCAACC

TGCTGACGCTGCAGCCTGCGCTGAGGACCCTCACCAACGACTACAATGGGCTCAAGCGGCAGGTGCGGGGCTTCCCCTTGCTGCTGCAGGAGGCTCTCAG

GAGTGTCAAAGCTGAG ATCGGCCAGGCCATCGAGGAGGTTAATAGCAACAACCAGGAGCTGTTGCGCAAGTACCGCCGGGAACTACAGCTGCGCAAGAA

ATGCCATAACGAGCTGGTCCGGCTGAAGG GAAACATCCGGGTGATTGCCCGAGTCCGGCCAGTCACCAAGGAGGATGGAGAAGGACCCGAGGCAACCAA

TGCTGTGACCTTTGACCCTGATGATGACTCCATCATCCACCTGCTGCACAAGGGCAAGCCCGTGTCCTTCGAGCTGGACAAGGTCTTCTCCCCGTGGGCT

TCCCAGCAGGAC GTGTTCCAGGAGGTGCAGGCCCTCATTACCTCCTGCATCGATGGCTTCAATGTCTGTATCTTTGCTTACGGCCAGACAGGTGCCGGC

AAGACATATACAATGGAG GGGACTCCCGAGAACCCGGGCATCAACCAGCGGGCCCTGCAGCTGCTCTTCTCGGAGGTGCAGGAGAAGGCGTCTGACTGG

CAGTACAACATCACCGTCAGCGCAGCTGAGATTTACAATGAAGTCCTCAG GGACCTGCTGGGGAAAGAGCCTCAGGAGAAGCTGGAGATCCGACTGTGC

CCGGATGGCAGTGGGCAACTGTATGTGCCAGGGCTGACTGAGTTCCAGGTGCAGAGCGTGGATGACATCAACAAG GTGTTTGAGTTTGGCTACAACAAC

CGCACCACCGAGTTCACCAACCTGAACGAACACAGCTCCCGCTCCCACGCTCTGCTCATCGTGACAGTGAGAGGTGTGGATTGCAGCACAGGCCTCCGCA

CCACGG GGAAGCTGAACCTGGTGGACCTGGCTGGTTCAGAGCGTGTGGGCAAGTCGGGGGCTGAGGGCAACCGCCTGCGAGAGGCACAGCACATCAACA

GGTCACTATCCGCCCTGGGGGACGTCATTGCTGCCCTGCGTTCTCGACAAGGCCATGTGCCCTTCCGCAATTCCAAACTCACCTACCTGCTGCAGGACTC

ACTCAGTGGTGACAGCAAGACCCTTATGGTGGTACAG GTGTCCCCAGTGGAGAAGAACACCAGCGAGACTCTGTACTCCCTCAGATTTGCTGAGAGGGT

TCGCTCTGTGGAGTTGGGCCCTGGGTCCCGCCGCACAGAGCTGGGTTCCTGGTCAAGCCAGGAGCACCTGGAG - UNI15467 - TGGGAGCCGGCTT

GCCAGACACCACAGCCTACAGCACGAGCCCACTCTGCCCCTGGCTCTGGGACCAGTAGCCGCCCAGGTTCCATCCGAAGGAAACTGCAGCCGTCAG - U

NI15467 - CCTGACAGCTGGGGCTGCAGTCTCCAG - UNI15467 - GGAAGTTGAGGCCAGTGCCTGTGTGAAGATGTGCCACGCTGCCAGGCCC

TGTGGCCTGGCGACCTGCTGTAACACCCACCTACCATGAATGCAGGAGATGGAGGCTCTCCCGCCCTGCCTCTCCTCAGAGATGAGAAACATGTTCAGAA

GGAAGCGAGTCTCTGTGTGGCTCTGGGCACCCAAGCATGGGGCTTCTGGAAGGGCAGGGATGGCACTCTGCCTGGTGGTAGGCTTGGGAGTCTAGCCGTT

GCTGGGAGGGTGGGCTCTCTCCCCACCTGGCCCTTGGGCTGGACTGTTCTCTACTAGTTGAGAAGACTTGAGGAACCAGCTGGGGGGTTAGGGAGAGCAA

GAGCATCTCTATCTACCCTCCTGAGGAGGGGAGCCCTCACAGGGCATGTATATAATGTTCTAGGTGTATATAGAAGTCCTCACCCTGTCAGAGGTCTGGG

CTATATTTATGGCTGGCAGAGGCCAGTGTGGAAGGGCTGGGTTCTGTTCATCTGCCTGACACCAGGCACTCTCCCTGCCCACTGATTCTCAACATGTTCC

TCTCCCCAAATCCTATTTAAGAACTTTTGGAAGCTTAGCCATTTTTACTTATTAAAATGAATGTCTTTTTA
Translation
 - UNI16704 - MVPSRRTWNLGATPSLRGLWRVGRVQEPKPGMARPAPASPAARPFPHTGQGRLRTG - UNI27686 - GRGKDILPSGEEDSTS

RTAARPSLAQCRALSVDWPGPRSPHRLYLTVQ - UNI20007 - VENLKEKLISQAQEVSRLRSEL GGTDAEKHRDRLMVENEQLRQELRRCEVELQ

ELRAQPVVPCEGCEHSQ ESSQLRDKLSQLQLEVAENKGMLSELNLEVQQKTDRLAEVELRLKDCLAEKAQEEERLSRRLRDSHETIASLRAQSPPVK Y

VIKTVEVESSKTKQALSESQTRNQHLQEQVAMQRQVLKEMEQQLQNSHQLTVQLRAQ IAMYEAELERAHGQMLEEMQSLEEDKNRAIEEAFARAQVEMK

AVHENLAG GVRTNLLTLQPALRTLTNDYNGLKRQVRGFPLLLQEALRSVKAE IGQAIEEVNSNNQELLRKYRRELQLRKKCHNELVRLKG GNIRVIA

RVRPVTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELDKVFSPWASQQD VFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTME GTPENPGIN

QRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLR RDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINK VFEFGYNNRTTEFTNLNEHSS

RSHALLIVTVRGVDCSTGLRTTG GKLNLVDLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVV

Q VSPVEKNTSETLYSLRFAERVRSVELGPGSRRTELGSWSSQEHLE - UNI15467 - WEPACQTPQPTARAHSAPGSGTSSRPGSIRRKLQPSA -

 UNI15467 - A - UNI15467 - 

For any suggestions or comments, please send an email to unitrap@crg.es