Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031789 (Cngb1)
Chromosomal location
Chr 8: 97762945 - 97808081 (-)
Description
cyclic nucleotide gated channel beta 1 Gene [Source:MGI (curated);Acc:Cngb1-001]
UniGene
Mm.172488 
MGI
MGI:2664102 
Uniprot/SPTREMBL
Q80VQ4 Q80XL8 
Human Ortholog
ENSG00000070729 (CNGB1)
Omim not available
UniTrap UNI25643
Vector Insertion
Chr 8: 97794702 - 97794866
Public Clones not available
Private Clones OST172096 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120044
Sequence
CACCAGCTCCGAGCTGAGCCAATCACAGCATCTTAGAAGCTGCTGTCCTGGCTGACCCAGGGCTTCTCCCGGCTCTACTCATATGCTCCCGTCCCAGGCT

TGGCTTCGCTGTCACAGCCCCAAGCTAACCTACTGCAACATGGCCCTTCCTACCAGCAGAGCCCGAAAGACCCAA TGTCCTGCTGGATAGCTGTTTGGT

GGTGCAGGCTGATGTGGACGAGTGCCAGCTAGAAAGGACACCGTCAGAGCTAGCATCGATCCAG GAGCTGCCAGAAGAGAAAGAGGAGAAGGAAGAGGA

GAAGGAGGAGGAGAAAGAGGAGGAGGAGGAAAAGAAGGAGGAAGAAGTGGAGAAGAAGGAGGAAGGGGAGGCCACAAACTCAACAG - UNI25643 - 

TACCAGCCACAAAGGAGCACCCGGAGCTCCAGGTAGAAGACACGGATGCTGATAGTGGCCCCCTCATCCCAGAGGAGACACTCCCTCCACCTGAGAGACC

ACCACCGTCTCCTGTCAAGTCGGACACCCTCACAGTTCCCGGCGCCGCTGCAGCAGGCCACAG - UNI25643 - GAAGAAGCTACCTTCTCAGGATG

ATGAGGCCGAAGAGCTCAAGGCCCTGTCACCAGCTGAGTCCCCAGTGGTTGCCTGGTCGGACCCCACCACCCCACAGGAGGCTGA TGGCCAGGACCGAG

CAGCCTCCACCGCCAGCCAGAACAGTGCCATCATCAATGACCGGCTCCAGGAGCTGGTGAAGATGTTCAAGGAGCGGACGGAGAAGGTGAAGGAGAAGCT

CATTGACCCTGACGTCACCTCTGATGAGGAGAGCCCCAAGCCCT CCCCGGCCAAGAAGGCCCCAGAACCAGACCCAGCCCAGAAGCCAGCGGAGGCAGA

GGTGGCAGAGGAGGAACACTACTGCGACATGCTCTGCTGCAAGTTCAAGCGCAGGCCCTTGAAGATGTACCGGTTCCCCCAGAGTATCGACCCACTGACC

A ACCTCATGTACATCTTGTGGCTGTTCTTTGTGGTGCTGGCCTGGAACTGGAACTGCTGGCTGATCCCTGTGCGCTGGGCCTTCCCGTACCAGCGGGCA

GACAACATCCACTTCTGGCTCCTCATGGATTACTTGTGCGACTTCATCTACCTCCTGGACATCACCGTGTTCCAGATGCGCCTGCAGTTTGTCAAAGGCG

GGGACATCATT ACAGACAAGAAGGAGATGCGTAATAACTACCTGAAGTCTCGCCGGTTTAAG ATGGACCTGCTCTGCCTCCTGCCCTTGGACTTTCTC

TACTTGAAACTTGGCATCAACCCTCTCCTTCGCCTGCCCCGCTGCCTGAAG TACATGGCCTTCTTTGAGTTTAATAACCGCCTGGAAGCCATCCTCAGC

AAAGCCTACGTTTACAG AGTCATCAGGACCACGGCCTACCTGCTGTACAGCCTGCACCTCAACTCCTGCCTTTACTACTGGGCATCAGCCTTCCAGGGC

ATCGGCTCCACTCACTGGGTTTACGACGGAGTGGGGAACAG TTATATTCGATGCTACTACTGGGCTGTGAAAACCCTCATCACCATCGGAGGACTGCCC

GACCCCCAGACGCTCTTTGAGATTGTCTTCCAGCTGCTGAACTATTTTACCGGGGTCTTTGCTTTCTCTGTGATGATTGGACAG ATGAGAGATGTGGTG

GGGGCCGCCACAGCGGGGCAGACCTACTACCGCAGCTGCATGGACAGCACAGTGAAGTACATGAACTTCTACAAGATCCCCAGGTCTGTGCAGAACCGTG

TCAAGACCTGGTATGAGTACACCTGGCATTCGCAAGGCATGCTGG ATGAGTCAGAGCTGATGGTACAACTTCCGGACAAGATGCGACTGGACCTGGCCA

TTGATGTGAACTACAGTATTGTCAGCAAAGTGGCCCTCTTTCAG GGCTGTGACCGGCAGATGATCTTCGACATGCTCAAGCGGCTTCGTTCTGTTGTCT

ACCTACCCAATGACTATGTGTGCAAGAAG GGGGAGATTGGCCGAGAGATGTACATTATCCAGGCGGGGCAGGTGCAGGTGCTGGGCGGCCCAGATGGGA

AGGCTGTACTGGTGACACTCAAAGCCGGATCGGTGTTTGGAGAAATAAG CTTGCTGGCTGTCGGGGGTGGCAACCGGCGCACAGCCAACGTGGTGGCCC

ATGGCTTCACCAACCTCTTCATACTGGACAAGAAGGACTTGAATGAAATTTTAGTGCATTACCCGGAATCTCAGAAGTTACTTCGGAAGAAGGCCAG GC

GCATGCTAAGAAATAACAACAAACCCAAGGAGGAAAAGAGTGTGCTCATCCTGCCCCCGCGTGCGGGCACCCCGAAGCTCTTCAATGCTGCCCTGGCTGC

TGCAGGAAAGATGGGCCCCAGGGGAGCCAAGGGCGGCAAGCTCGCCCACCTGAGAGCCAGGCTCAAGGAACTGGCTGCACTGGAGGCAGCCGCGCGACAG

CAACAGCTGCTGGAACAG GCCAAGAGCTCGCAAGAAGCTGGGGGAGAGGAGGGCTCTGGGGCCACAGACCAACCTGCACCCCAGGAGCCACCAGAGCCC

AAGGACCCTCCGAAGCCACCAGGGCCACCAGAGCCCTCAGCCCAGAGCTCTCCACCTCCAGCCTCAGCAAAGCCCGAGGAAAGCACGGGGGAGGCAGCAG

GGCCCCCGGAGCCCTCGGTGAGGATCCGTGTGAGTCCAGGCCCTGATCCCGGGGAGCAGACACTGTCGGTGGAGGTGCTGGAGGAGAAGAAAGAGGGGGC

GGAGTGAGGTGCATGAAGCGCCCAGATCCCATCCCCAGGTCTTTGAACCACCCGCCTCGCCAAGCGTCCCAGCCTAAGGGCGCCTTCTCACAGGCTTGTA

GAAACGCTCAAATTTCACCAGGTGGTAGTGATGCCCTCGAGCTCCTGCCATTCCCTGAGCACCCTGCTCCCTTCCTGAGGTTGCTATTTTCAAGAAGAAA

ACCGCCTTGTACTTCTCAAA
Translation
   - UNI25643 -  - UNI25643 -  MFKERTEKVKEKLIDPDVTSDEESPKPS SPAKKAPEPDPAQKPAEAEVAEEEHYCDMLCCKFKRRPLK

MYRFPQSIDPLTN NLMYILWLFFVVLAWNWNCWLIPVRWAFPYQRADNIHFWLLMDYLCDFIYLLDITVFQMRLQFVKGGDII TDKKEMRNNYLKSRR

FK MDLLCLLPLDFLYLKLGINPLLRLPRCLK YMAFFEFNNRLEAILSKAYVYR RVIRTTAYLLYSLHLNSCLYYWASAFQGIGSTHWVYDGVGNS S

YIRCYYWAVKTLITIGGLPDPQTLFEIVFQLLNYFTGVFAFSVMIGQ MRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGM

LD DESELMVQLPDKMRLDLAIDVNYSIVSKVALFQ GCDRQMIFDMLKRLRSVVYLPNDYVCKK GEIGREMYIIQAGQVQVLGGPDGKAVLVTLKAGS

VFGEIS SLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKAR RRMLRNNNKPKEEKSVLILPPRAGTPKLFNAALAAAGKMGPR

GAKGGKLAHLRARLKELAALEAAARQQQLLEQ AKSSQEAGGEEGSGATDQPAPQEPPEPKDPPKPPGPPEPSAQSSPPPASAKPEESTGEAAGPPEPSV

RIRVSPGPDPGEQTLSVEVLEEKKEGAE
Transcript ENSMUST00000121162
Sequence
GTGGCTAAACCCAGGAAGGACACCAGCTCCGAGCTGAGCCAATCACAGCATCTTAGAAGCTGCTGTCCTGGCTGACCCAGGGCTTCTCCCGGCTCTACTC

ATATGCTCCCGTCCCAGGCTTGGCTTCGCTGTCACAGCCCCAAGCTAACCTACTGCAACATGGCCCTTCCTACCAGCAGAGCCCGAAAGACCCAAGTAGG

TGACCGCTCCTGACCCTGAACTCTTGTCCTCTCTTCCTCCTGAGCTGGAATTTCAGAGGAGGACCATGCTGAAG TGTCCTGCTGGATAGCTGTTTGGTG

GTGCAGGCTGATGTGGACGAGTGCCAGCTAGAAAGGACACCGTCAGAGCTAGCATCGATCCAG GAGCTGCCAGAAGAGAAAGAGGAGAAGGAAGAGGAG

AAGGAGGAGGAGAAAGAGGAGGAGGAGGAAAAGAAGGAGGAAGAAGTGGAGAAGAAGGAGGAAGGGGAGGCCACAAACTCAACAG - UNI25643 - T

ACCAGCCACAAAGGAGCACCCGGAGCTCCAGGTAGAAGACACGGATGCTGATAGTGGCCCCCTCATCCCAGAGGAGACACTCCCTCCACCTGAGAGACCA

CCACCGTCTCCTGTCAAGTCGGACACCCTCACAGTTCCCGGCGCCGCTGCAGCAGGCCACAG - UNI25643 - GAAGAAGCTACCTTCTCAGGATGA

TGAGGCCGAAGAGCTCAAGGCCCTGTCACCAGCTGAGTCCCCAGTGGTTGCCTGGTCGGACCCCACCACCCCACAGGAGGCTGA TGGCCAGGACCGAGC

AGCCTCCACCGCCAGCCAGAACAGTGCCATCATCAATGACCGGCTCCAGGAGCTGGTGAAGATGTTCAAGGAGCGGACGGAGAAGGTGAAGGAGAAGCTC

ATTGACCCTGACGTCACCTCTGATGAGGAGAGCCCCAAGCCCT CCCCGGCCAAGAAGGCCCCAGAACCAGACCCAGCCCAGAAGCCAGCGGAGGCAGAG

GTGGCAGAGGAGGAACACTACTGCGACATGCTCTGCTGCAAGTTCAAGCGCAGGCCCTTGAAGATGTACCGGTTCCCCCAGAGTATCGACCCACTGACCA

 ACCTCATGTACATCTTGTGGCTGTTCTTTGTGGTGCTGGCCTGGAACTGGAACTGCTGGCTGATCCCTGTGCGCTGGGCCTTCCCGTACCAGCGGGCAG

ACAACATCCACTTCTGGCTCCTCATGGATTACTTGTGCGACTTCATCTACCTCCTGGACATCACCGTGTTCCAGATGCGCCTGCAGTTTGTCAAAGGCGG

GGACATCATT ACAGACAAGAAGGAGATGCGTAATAACTACCTGAAGTCTCGCCGGTTTAAG ATGGACCTGCTCTGCCTCCTGCCCTTGGACTTTCTCT

ACTTGAAACTTGGCATCAACCCTCTCCTTCGCCTGCCCCGCTGCCTGAAG TACATGGCCTTCTTTGAGTTTAATAACCGCCTGGAAGCCATCCTCAGCA

AAGCCTACGTTTACAG AGTCATCAGGACCACGGCCTACCTGCTGTACAGCCTGCACCTCAACTCCTGCCTTTACTACTGGGCATCAGCCTTCCAGGGCA

TCGGCTCCACTCACTGGGTTTACGACGGAGTGGGGAACAG TTATATTCGATGCTACTACTGGGCTGTGAAAACCCTCATCACCATCGGAGGACTGCCCG

ACCCCCAGACGCTCTTTGAGATTGTCTTCCAGCTGCTGAACTATTTTACCGGGGTCTTTGCTTTCTCTGTGATGATTGGACAG ATGAGAGATGTGGTGG

GGGCCGCCACAGCGGGGCAGACCTACTACCGCAGCTGCATGGACAGCACAGTGAAGTACATGAACTTCTACAAGATCCCCAGGTCTGTGCAGAACCGTGT

CAAGACCTGGTATGAGTACACCTGGCATTCGCAAGGCATGCTGG ATGAGTCAGAGCTGATGGTACAACTTCCGGACAAGATGCGACTGGACCTGGCCAT

TGATGTGAACTACAGTATTGTCAGCAAAGTGGCCCTCTTTCAG GGCTGTGACCGGCAGATGATCTTCGACATGCTCAAGCGGCTTCGTTCTGTTGTCTA

CCTACCCAATGACTATGTGTGCAAGAAG GGGGAGATTGGCCGAGAGATGTACATTATCCAGGCGGGGCAGGTGCAGGTGCTGGGCGGCCCAGATGGGAA

GGCTGTACTGGTGACACTCAAAGCCGGATCGGTGTTTGGAGAAATAAG CTTGCTGGCTGTCGGGGGTGGCAACCGGCGCACAGCCAACGTGGTGGCCCA

TGGCTTCACCAACCTCTTCATACTGGACAAGAAGGACTTGAATGAAATTTTAGTGCATTACCCGGAATCTCAGAAGTTACTTCGGAAGAAGGCCAG GCG

CATGCTAAGAAATAACAACAAACCCAAGGAGGAAAAGAGTGTGCTCATCCTGCCCCCGCGTGCGGGCACCCCGAAGCTCTTCAATGCTGCCCTGGCTGCT

GCAGGAAAGATGGGCCCCAGGGGAGCCAAGGGCGGCAAGCTCGCCCACCTGAGAGCCAGGCTCAAGGAACTGGCTGCACTGGAGGCAGCCGCGCGACAGC

AACAGCTGCTGGAACAG GCCAAGAGCTCGCAAGAAGCTGGGGGAGAGGAGGGCTCTGGGGCCACAGACCAACCTGCACCCCAGGAGCCACCAGAGCCCA

AGGACCCTCCGAAGCCACCAGGGCCACCAGAGCCCTCAGCCCAGAGCTCTCCACCTCCAGCCTCAGCAAAGCCCGAGGAAAGCACGGGGGAGGCAGCAGG

GCCCCCGGAGCCCTCGGTGAGGATCCGTGTGAGTCCAGGCCCTGATCCCGGGGAGCAGACACTGTCGGTGGAGGTGCTGGAGGAGAAGAAAGAGGGGGCG

GAGTGAGGTGCATGAAGCGCCCAGATCCCATCCCCAGGTCTTTGAACCACCCGCCTCGCCAAGCGTCCCAGCCTAAGGGCGCCTTCTCACAGGCTTGTAG

AAACGCTCAAATTTCACCAGGTGGTAGTGATGCCCTCGAGCTCCTGCCATTCCCTGAGCACCCTGCTCCCTTCCTGAGGTTGCTATTTTCAAGAAGAAAA

CCGCCTTGTACTT
Translation
   - UNI25643 -  - UNI25643 -  MFKERTEKVKEKLIDPDVTSDEESPKPS SPAKKAPEPDPAQKPAEAEVAEEEHYCDMLCCKFKRRPLK

MYRFPQSIDPLTN NLMYILWLFFVVLAWNWNCWLIPVRWAFPYQRADNIHFWLLMDYLCDFIYLLDITVFQMRLQFVKGGDII TDKKEMRNNYLKSRR

FK MDLLCLLPLDFLYLKLGINPLLRLPRCLK YMAFFEFNNRLEAILSKAYVYR RVIRTTAYLLYSLHLNSCLYYWASAFQGIGSTHWVYDGVGNS S

YIRCYYWAVKTLITIGGLPDPQTLFEIVFQLLNYFTGVFAFSVMIGQ MRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGM

LD DESELMVQLPDKMRLDLAIDVNYSIVSKVALFQ GCDRQMIFDMLKRLRSVVYLPNDYVCKK GEIGREMYIIQAGQVQVLGGPDGKAVLVTLKAGS

VFGEIS SLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKAR RRMLRNNNKPKEEKSVLILPPRAGTPKLFNAALAAAGKMGPR

GAKGGKLAHLRARLKELAALEAAARQQQLLEQ AKSSQEAGGEEGSGATDQPAPQEPPEPKDPPKPPGPPEPSAQSSPPPASAKPEESTGEAAGPPEPSV

RIRVSPGPDPGEQTLSVEVLEEKKEGAE
Transcript ENSMUST00000119870
Sequence
GAAGAAGAGCCTAT TGTCCTGCTGGATAGCTGTTTGGTGGTGCAGGCTGATGTGGACGAGTGCCAGCTAGAAAGGACACCGTCAGAGCTAGCATCGATC

CAG GAGCTGCCAGAAGAGAAAGAGGAGAAGGAAGAGGAGAAGGAGGAGGAGAAAGAGGAGGAGGAGGAAAAGAAGGAGGAAGAAGTGGAGAAGAAGGAG

GAAGGGGAGGCCACAAACTCAACAG - UNI25643 - TACCAGCCACAAAGGAGCACCCGGAGCTCCAGGTAGAAGACACGGATGCTGATAGTGGCCC

CCTCATCCCAGAGGAGACACTCCCTCCACCTGAGAGACCACCACCGTCTCCTGTCAAGTCGGACACCCTCACAGTTCCCGGCGCCGCTGCAGCAGGCCAC

AG - UNI25643 - GAAGAAGCTACCTTCTCAGGATGATGAGGCCGAAGAGCTCAAGGCCCTGTCACCAGCTGAGTCCCCAGTGGTTGCCTGGTCGGA

CCCCACCACCCCACAGGAGGCTGA TGGCCAGGACCGAGCAGCCTCCACCGCCAGCCAGAACAGTGCCATCATCAATGACCGGCTCCAGGAGCTGGTGAA

GATGTTCAAGGAGCGGACGGAGAAGGTGAAGGAGAAGCTCATTGACCCTGACGTCACCTCTGATGAGGAGAGCCCCAAGCCCT CCCCGGCCAAGAAGGC

CCCAGAACCAGACCCAGCCCAGAAGCCAGCGGAGGCAGAGGTGGCAGAGGAGGAACACTACTGCGACATGCTCTGCTGCAAGTTCAAGCGCAGGCCCTTG

AAGATGTACCGGTTCCCCCAGAGTATCGACCCACTGACCA ACCTCATGTACATCTTGTGGCTGTTCTTTGTGGTGCTGGCCTGGAACTGGAACTGCTGG

CTGATCCCTGTGCGCTGGGCCTTCCCGTACCAGCGGGCAGACAACATCCACTTCTGGCTCCTCATGGATTACTTGTGCGACTTCATCTACCTCCTGGACA

TCACCGTGTTCCAGATGCGCCTGCAGTTTGTCAAAGGCGGGGACATCATT ACAGACAAGAAGGAGATGCGTAATAACTACCTGAAGTCTCGCCGGTTTA

AG ATGGACCTGCTCTGCCTCCTGCCCTTGGACTTTCTCTACTTGAAACTTGGCATCAACCCTCTCCTTCGCCTGCCCCGCTGCCTGAAG TACATGGCC

TTCTTTGAGTTTAATAACCGCCTGGAAGCCATCCTCAGCAAAGCCTACGTTTACAG AGTCATCAGGACCACGGCCTACCTGCTGTACAGCCTGCACCTC

AACTCCTGCCTTTACTACTGGGCATCAGCCTTCCAGGGCATCGGCTCCACTCACTGGGTTTACGACGGAGTGGGGAACAG TTATATTCGATGCTACTAC

TGGGCTGTGAAAACCCTCATCACCATCGGAGGACTGCCCGACCCCCAGACGCTCTTTGAGATTGTCTTCCAGCTGCTGAACTATTTTACCGGGGTCTTTG

CTTTCTCTGTGATGATTGGACAG ATGAGAGATGTGGTGGGGGCCGCCACAGCGGGGCAGACCTACTACCGCAGCTGCATGGACAGCACAGTGAAGTACA

TGAACTTCTACAAGATCCCCAGGTCTGTGCAGAACCGTGTCAAGACCTGGTATGAGTACACCTGGCATTCGCAAGGCATGCTGG ATGAGTCAGAGCTGA

TGGTACAACTTCCGGACAAGATGCGACTGGACCTGGCCATTGATGTGAACTACAGTATTGTCAGCAAAGTGGCCCTCTTTCAG GGCTGTGACCGGCAGA

TGATCTTCGACATGCTCAAGCGGCTTCGTTCTGTTGTCTACCTACCCAATGACTATGTGTGCAAGAAG GGGGAGATTGGCCGAGAGATGTACATTATCC

AGGCGGGGCAGGTGCAGGTGCTGGGCGGCCCAGATGGGAAGGCTGTACTGGTGACACTCAAAGCCGGATCGGTGTTTGGAGAAATAAG CTTGCTGGCTG

TCGGGGGTGGCAACCGGCGCACAGCCAACGTGGTGGCCCATGGCTTCACCAACCTCTTCATACTGGACAAGAAGGACTTGAATGAAATTTTAGTGCATTA

CCCGGAATCTCAGAAGTTACTTCGGAAGAAGGCCAG GCGCATGCTAAGAAATAACAACAAACCCAAGGAGGAAAAGAGTGTGCTCATCCTGCCCCCGCG

TGCGGGCACCCCGAAGCTCTTCAATGCTGCCCTGGCTGCTGCAGGAAAGATGGGCCCCAGGGGAGCCAAGGGCGGCAAGCTCGCCCACCTGAGAGCCAGG

CTCAAGGAACTGGCTGCACTGGAGGCAGCCGCGCGACAGCAACAGCTGCTGGAACAG GCCAAGAGCTCGCAAGAAGCTGGGGGAGAGGAGGGCTCTGGG

GCCACAGACCAACCTGCACCCCAGGAGCCACCAGAGCCCAAGGACCCTCCGAAGCCACCAGGGCCACCAGAGCCCTCAGCCCAGAGCTCTCCACCTCCAG

CCTCAGCAAAGCCCGAGGAAAGCACGGGGGAGGCAGCAGGGCCCCCGGAGCCCTCGGTGAGGATCCGTGTGAGTCCAGGCCCTGATCCCGGGGAGCAGAC

ACTGTCGGTGGAGGTGCTGGAGGAGAAGAAAGAGGGGGCGGAGTGAGGTGCATGAAGCGCCCAGATCCCATCCCCAGGTCTTTGAACCACCCGCCTCGCC

AAGCGTCCCAGCCTAAGGGCGCCTTCTCACAGGCTTGTAGAAACGCTCAAATTTCACCAGGTGGTAGTGATGCCCTCGAGCTCCTGCCATTCCCTGAGCA

CCCTGCTCCCTTCCTGAGGTTGCTATTTTCAAGAAGAAAACCGCCTTGTACTTCTCAAAGATTTGAGGAGAGACTAGAAGAGGGCTCCAACATCAAGGAG

AACTCTACTAGACAAATCAAGGGTTGATGACTTGGTAGGGTCCCCACCAGAAGCCACCCTCTGTTTAAATGGTGAAGAGCTGGAGTCCCACTGAGCACCT

GCAAACCCAGGACTGGGGAGACCAAGATAGTCCTTGGTTCAAGGGCAGCCAGGGCTACATAGTGAGACTCTGCCTCAAAAGAAAACAGTAGCAAAATTGC

TTGAGGAGTTCCCAGGCACCTCGTGACCCCTTTGGGGTCCAAAGACCCTTTGATGGGGGGGAGGGTCGCCTAAGACTATTGTAAAGATCAGATATTTACA

TTATGATTCACAACAGTAGCAAAATAACAGTAATAAAGTAGCATTGGAAATAATGGTTAGGGGTCACCACAACACAAGGAACTGTGTTAAAGGGTCACAG

TGTGAGAAAGGTTGAGAATCACCGAGCTAAGCTCATCCACATCCCAGCAGTAAACACAGTTGTCTAGCTGATGGCAGGGCAGGTGATCCCGGTATTCCTT

GCTCCAGGTAGTGATGGCTGCATTATCATCTTAGCGCCCTTGAAAGTATTGCTTATCTTAGTAGGTAACGATATCAAGAGCTCTCCATGCTACTCTGGTC

CTAGCATTTAGAGAGTATGCTTGTAGCTGGGTGTCATGGAGGCAGGGGGATCAGCCTGGGCTAGATAGCAATATCCCATCTTAAAAAGGAAAGGGGGAAG

TGTATTGGTTCATTGGTGATGACAGCACAGTCCATGTTTAAATGCGTGGTGACATCTCAGCCACTGCTCATCAGTGAGCCTTTGGATTGTTTTCTGATCT

CACTCTATCAAGAATAACATGGCAGGGCCATTGAGAGAGCTCAGTGGGCAGAGGCCCTTGCCACCCTACCATGCAAACGTGATGACCTAAGTTATATCTC

TGAAACCCATGTGAAGCTGCAAAGTCGACTCCACGAGCTCGCAGTAATAAACTCATCTCCTACACATGGGGTGGCTCACTAGGAAGCATTTACCTGGCCT

GTGTGACTTCCTGGGTTTGATCCTCAATACCAAAAGAAAGAACCTCACACAGAGCTAATCTCTCACTAGCACACTTTATTTTTTTAAGCGATGTGGGGTG

GGGTCTGGGAGTCTAGTCAGTTTTGTTTTTGTTGTTGTTTGTTTTTTTAACCCTAACATCCTTAAACAGCATCCTCAGAGCTGCATCCTATGTTCTAAAG

CCCGGGCCCTGAGAATGCTACCCGCTTGTGGCCAGTATTCCGGATGCTCCTACAGAGTAAACATGCCACCCTTCAGTAAACGGTGGCATGTGTCCCTGGC

GCCTCCACGTGAGAGCCTGCTTCATGCGGAATCTGTTTTCTGTGAATGCACCTACTTTTAGATGCTAGCCCTTGAAAATATATTGCTTATTATATGAAGC

AAGAGGTTCCCGTGGTTCCTGGGAAGAACGTTAATTTCGAAATGAGATCGGCAGTGTCTTAATTTCACTGAGCTATCTCATTTACGGTGAGACTCACAGA

AACAAGATGTTAGGTAAACTGAGTTGGAGACCGGCACTAATCTCCTGTCTGAATTGGACTGGCTGGCCACTGATATAGTCCAGAGATTGCTGTAATCCTG

AAGCCTGAAGAGAACACGCATGTGTGCCCATTGATTCTCTCCTCTTTTAATCTCCTTGTTGGGTCTTGCATTGATAATTTGATTGATAATGAACAGCATA

CCACTTTTTTTAAAAAAACCATATAAATATTCTAAATAGAACTAAAACCAAGAAGCTGCTTAAAAACTTCATTATCAAAATATGCTCAGCCATCGGAACT

AGTCTAAGCTGTTTCCACAGCACACAAGAATACTTTCTGTACACGCCGGCTTTCACAGTACAGCTCATTTTAATTAATTAAAGAGTTTAGACAAA
Translation
   - UNI25643 -  - UNI25643 -  MFKERTEKVKEKLIDPDVTSDEESPKPS SPAKKAPEPDPAQKPAEAEVAEEEHYCDMLCCKFKRRPLK

MYRFPQSIDPLTN NLMYILWLFFVVLAWNWNCWLIPVRWAFPYQRADNIHFWLLMDYLCDFIYLLDITVFQMRLQFVKGGDII TDKKEMRNNYLKSRR

FK MDLLCLLPLDFLYLKLGINPLLRLPRCLK YMAFFEFNNRLEAILSKAYVYR RVIRTTAYLLYSLHLNSCLYYWASAFQGIGSTHWVYDGVGNS S

YIRCYYWAVKTLITIGGLPDPQTLFEIVFQLLNYFTGVFAFSVMIGQ MRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGM

LD DESELMVQLPDKMRLDLAIDVNYSIVSKVALFQ GCDRQMIFDMLKRLRSVVYLPNDYVCKK GEIGREMYIIQAGQVQVLGGPDGKAVLVTLKAGS

VFGEIS SLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKAR RRMLRNNNKPKEEKSVLILPPRAGTPKLFNAALAAAGKMGPR

GAKGGKLAHLRARLKELAALEAAARQQQLLEQ AKSSQEAGGEEGSGATDQPAPQEPPEPKDPPKPPGPPEPSAQSSPPPASAKPEESTGEAAGPPEPSV

RIRVSPGPDPGEQTLSVEVLEEKKEGAE
Transcript ENSMUST00000070212
Sequence
GAAGAAGAGCCTAT TGTCCTGCTGGATAGCTGTTTGGTGGTGCAGGCTGATGTGGACGAGTGCCAGCTAGAAAGGACACCGTCAGAGCTAGCATCGATC

CAG GAGCTGCCAGAAGAGAAAGAGGAGAAGGAAGAGGAGAAGGAGGAGGAGAAAGAGGAGGAGGAGGAAAAGAAGGAGGAAGAAGTGGAGAAGAAGGAG

GAAGGGGAGGCCACAAACTCAACAG - UNI25643 - TACCAGCCACAAAGGAGCACCCGGAGCTCCAGGTAGAAGACACGGATGCTGATAGTGGCCC

CCTCATCCCAGAGGAGACACTCCCTCCACCTGAGAGACCACCACCGTCTCCTGTCAAGTCGGACACCCTCACAGTTCCCGGCGCCGCTGCAGCAGGCCAC

AG - UNI25643 - GAAGAAGCTACCTTCTCAGGATGATGAGGCCGAAGAGCTCAAGGCCCTGTCACCAGCTGAGTCCCCAGTGGTTGCCTGGTCGGA

CCCCACCACCCCACAGGAGGCTGA TGGCCAGGACCGAGCAGCCTCCACCGCCAGCCAGAACAGTGCCATCATCAATGACCGGCTCCAGGAGCTGGTGAA

GATGTTCAAGGAGCGGACGGAGAAGGTGAAGGAGAAGCTCATTGACCCTGACGTCACCTCTGATGAGGAGAGCCCCAAGCCCT CCCCGGCCAAGAAGGC

CCCAGAACCAGACCCAGCCCAGAAGCCAGCGGAGGCAGAGGTGGCAGAGGAGGAACACTACTGCGACATGCTCTGCTGCAAGTTCAAGCGCAGGCCCTTG

AAGATGTACCGGTTCCCCCAGAGTATCGACCCACTGACCA ACCTCATGTACATCTTGTGGCTGTTCTTTGTGGTGCTGGCCTGGAACTGGAACTGCTGG

CTGATCCCTGTGCGCTGGGCCTTCCCGTACCAGCGGGCAGACAACATCCACTTCTGGCTCCTCATGGATTACTTGTGCGACTTCATCTACCTCCTGGACA

TCACCGTGTTCCAGATGCGCCTGCAGTTTGTCAAAGGCGGGGACATCATT ACAGACAAGAAGGAGATGCGTAATAACTACCTGAAGTCTCGCCGGTTTA

AG ATGGACCTGCTCTGCCTCCTGCCCTTGGACTTTCTCTACTTGAAACTTGGCATCAACCCTCTCCTTCGCCTGCCCCGCTGCCTGAAG TACATGGCC

TTCTTTGAGTTTAATAACCGCCTGGAAGCCATCCTCAGCAAAGCCTACGTTTACAG AGTCATCAGGACCACGGCCTACCTGCTGTACAGCCTGCACCTC

AACTCCTGCCTTTACTACTGGGCATCAGCCTTCCAGGGCATCGGCTCCACTCACTGGGTTTACGACGGAGTGGGGAACAG TTATATTCGATGCTACTAC

TGGGCTGTGAAAACCCTCATCACCATCGGAGGACTGCCCGACCCCCAGACGCTCTTTGAGATTGTCTTCCAGCTGCTGAACTATTTTACCGGGGTCTTTG

CTTTCTCTGTGATGATTGGACAG ATGAGAGATGTGGTGGGGGCCGCCACAGCGGGGCAGACCTACTACCGCAGCTGCATGGACAGCACAGTGAAGTACA

TGAACTTCTACAAGATCCCCAGGTCTGTGCAGAACCGTGTCAAGACCTGGTATGAGTACACCTGGCATTCGCAAGGCATGCTGG ATGAGTCAGAGCTGA

TGGTACAACTTCCGGACAAGATGCGACTGGACCTGGCCATTGATGTGAACTACAGTATTGTCAGCAAAGTGGCCCTCTTTCAG GGCTGTGACCGGCAGA

TGATCTTCGACATGCTCAAGCGGCTTCGTTCTGTTGTCTACCTACCCAATGACTATGTGTGCAAGAAG GGGGAGATTGGCCGAGAGATGTACATTATCC

AGGCGGGGCAGGTGCAGGTGCTGGGCGGCCCAGATGGGAAGGCTGTACTGGTGACACTCAAAGCCGGATCGGTGTTTGGAGAAATAAG CTTGCTGGCTG

TCGGGGGTGGCAACCGGCGCACAGCCAACGTGGTGGCCCATGGCTTCACCAACCTCTTCATACTGGACAAGAAGGACTTGAATGAAATTTTAGTGCATTA

CCCGGAATCTCAGAAGTTACTTCGGAAGAAGGCCAG GCGCATGCTAAGAAATAACAACAAACCCAAGGAGGAAAAGAGTGTGCTCATCCTGCCCCCGCG

TGCGGGCACCCCGAAGCTCTTCAATGCTGCCCTGGCTGCTGCAGGAAAGATGGGCCCCAGGGGAGCCAAGGGCGGCAAGCTCGCCCACCTGAGAGCCAGG

CTCAAGGAACTGGCTGCACTGGAGGCAGCCGCGCGACAGCAACAGCTGCTGGAACAG GCCAAGAGCTCGCAAGAAGCTGGGGGAGAGGAGGGCTCTGGG

GCCACAGACCAACCTGCACCCCAGGAGCCACCAGAGCCCAAGGACCCTCCGAAGCCACCAGGGCCACCAGAGCCCTCAGCCCAGAGCTCTCCACCTCCAG

CCTCAGCAAAGCCCGAGGAAAGCACGGGGGAGGCAGCAGGGCCCCCGGAGCCCTCGGTGAGGATCCGTGTGAGTCCAGGCCCTGATCCCGGGGAGCAGAC

ACTGTCGGTGGAGGTGCTGGAGGAGAAGAAAGAGGGGGCGGAGTGAGGTGCATGAAGCGCCCAGATCCCATCCCCAGGTCTTTGAACCACCCGCCTCGCC

AAGCGTCCCAGCCTAAGGGCGCCTTCTCACAGGCTTGTAGAAACGCTCAAATTTCACCAGGTGGTAGTGATGCCCTCGAGCTCCTGCCATTCCCTGAGCA

CCCTGCTCCCTTCCTGAGGTTGCTATTTTCAAGAAGAAAACCGCCTTGTACTTCTCAAAGATTTGAGGAGAGACTAGAAGAGGGCTCCAACATCAAGGAG

AACTCTACTAGACAAATCAAGGGTTGATGACTTGGTAGGGTCCCCACCAGAAGCCACCCTCTGTTTAAATGGTGAAGAGCTGGAGTCCCACTGAGCACCT

GCAAACCCAGGACTGGGGAGACCAAGATAGTCCTTGGTTCAAGGGCAGCCAGGGCTACATAGTGAGACTCTGCCTCAAAAGAAAACAGTAGCAAAATTGC

TTGAGGAGTTCCCAGGCACCTCGTGACCCCTTTGGGGTCCAAAGACCCTTTGATGGGGGGGAGGGTCGCCTAAGACTATTGTAAAGATCAGATATTTACA

TTATGATTCACAACAGTAGCAAAATAACAGTAATAAAGTAGCATTGGAAATAATGGTTAGGGGTCACCACAACACAAGGAACTGTGTTAAAGGGTCACAG

TGTGAGAAAGGTTGAGAATCACCGAGCTAAGCTCATCCACATCCCAGCAGTAAACACAGTTGTCTAGCTGATGGCAGGGCAGGTGATCCCGGTATTCCTT

GCTCCAGGTAGTGATGGCTGCATTATCATCTTAGCGCCCTTGAAAGTATTGCTTATCTTAGTAGGTAACGATATCAAGAGCTCTCCATGCTACTCTGGTC

CTAGCATTTAGAGAGTATGCTTGTAGCTGGGTGTCATGGAGGCAGGGGGATCAGCCTGGGCTAGATAGCAATATCCCATCTTAAAAAGGAAAGGGGGAAG

TGTATTGGTTCATTGGTGATGACAGCACAGTCCATGTTTAAATGCGTGGTGACATCTCAGCCACTGCTCATCAGTGAGCCTTTGGATTGTTTTCTGATCT

CACTCTATCAAGAATAACATGGCAGGGCCATTGAGAGAGCTCAGTGGGCAGAGGCCCTTGCCACCCTACCATGCAAACGTGATGACCTAAGTTATATCTC

TGAAACCCATGTGAAGCTGCAAAGTCGACTCCACGAGCTCGCAGTAATAAACTCATCTCCTACACATGGGGTGGCTCACTAGGAAGCATTTACCTGGCCT

GTGTGACTTCCTGGGTTTGATCCTCAATACCAAAAGAAAGAACCTCACACAGAGCTAATCTCTCACTAGCACACTTTATTTTTTTAAGCGATGTGGGGTG

GGGTCTGGGAGTCTAGTCAGTTTTGTTTTTGTTGTTGTTTGTTTTTTTAACCCTAACATCCTTAAACAGCATCCTCAGAGCTGCATCCTATGTTCTAAAG

CCCGGGCCCTGAGAATGCTACCCGCTTGTGGCCAGTATTCCGGATGCTCCTACAGAGTAAACATGCCACCCTTCAGTAAACGGTGGCATGTGTCCCTGGC

GCCTCCACGTGAGAGCCTGCTTCATGCGGAATCTGTTTTCTGTGAATGCACCTACTTTTAGATGCTAGCCCTTGAAAATATATTGCTTATTATATGAAGC

AAGAGGTTCCCGTGGTTCCTGGGAAGAACGTTAATTTCGAAATGAGATCGGCAGTGTCTTAATTTCACTGAGCTATCTCATTTACGGTGAGACTCACAGA

AACAAGATGTTAGGTAAACTGAGTTGGAGACCGGCACTAATCTCCTGTCTGAATTGGACTGGCTGGCCACTGATATAGTCCAGAGATTGCTGTAATCCTG

AAGCCTGAAGAGAACACGCATGTGTGCCCATTGATTCTCTCCTCTTTTAATCTCCTTGTTGGGTCTTGCATTGATAATTTGATTGATAATGAACAGCATA

CCACTTTTTTTAAAAAAACCATATAAATATTCTAAATAGAACTAAAACCAAGAAGCTGCTTAAAAACTTCATTATCAAAATATGCTCAGCCATCGGAACT

AGTCTAAGCTGTTTCCACAGCACACAAGAATACTTTCTGTACACGCCGGCTTTCACAGTACAGCTCATTTTAATTAATTAAAGAGTTTAG
Translation
EEEPI IVLLDSCLVVQADVDECQLERTPSELASIQ ELPEEKEEKEEEKEEEKEEEEEKKEEEVEKKEEGEATNSTV - UNI25643 - VPATKEHP

ELQVEDTDADSGPLIPEETLPPPERPPPSPVKSDTLTVPGAAAAGHR - UNI25643 - RKKLPSQDDEAEELKALSPAESPVVAWSDPTTPQEAD D

GQDRAASTASQNSAIINDRLQELVKMFKERTEKVKEKLIDPDVTSDEESPKPS SPAKKAPEPDPAQKPAEAEVAEEEHYCDMLCCKFKRRPLKMYRFPQ

SIDPLTN NLMYILWLFFVVLAWNWNCWLIPVRWAFPYQRADNIHFWLLMDYLCDFIYLLDITVFQMRLQFVKGGDII TDKKEMRNNYLKSRRFK MDL

LCLLPLDFLYLKLGINPLLRLPRCLK YMAFFEFNNRLEAILSKAYVYR RVIRTTAYLLYSLHLNSCLYYWASAFQGIGSTHWVYDGVGNS SYIRCYY

WAVKTLITIGGLPDPQTLFEIVFQLLNYFTGVFAFSVMIGQ MRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGMLD DES

ELMVQLPDKMRLDLAIDVNYSIVSKVALFQ GCDRQMIFDMLKRLRSVVYLPNDYVCKK GEIGREMYIIQAGQVQVLGGPDGKAVLVTLKAGSVFGEIS

 SLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKAR RRMLRNNNKPKEEKSVLILPPRAGTPKLFNAALAAAGKMGPRGAKGGK

LAHLRARLKELAALEAAARQQQLLEQ AKSSQEAGGEEGSGATDQPAPQEPPEPKDPPKPPGPPEPSAQSSPPPASAKPEESTGEAAGPPEPSVRIRVSP

GPDPGEQTLSVEVLEEKKEGAE

For any suggestions or comments, please send an email to unitrap@crg.es