Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031792 (AA960436)
Chromosomal location
Chr 8: 97856203 - 97871407 (+)
Description
UPF0406 protein C16orf57 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q91W78]
RefSeq_dna
NM_133954 
RefSeq_peptide
NP_598715.1 
UniGene
Mm.29069 Mm.394399 
MGI
MGI:2142454 
Uniprot/SWISSPROT
Q91W78 
Human Ortholog
ENSG00000103005 (C16orf57)
Omim not available
UniTrap UNI27552
Vector Insertion
Chr 8: 97856366 - 97857267
Public Clones not available
Private Clones OST57005 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034245
Sequence
AGAGGAACTCCGGGCGTCGGATCAGGTTGTCGGTGGACACGGCTTGTGGTCGAGGCCCCATGAGCTCGGCGCCCCTGGTGGGCTACAGCAGCAGCGGTTC

AGAGGATGAAGCGGAGGCTGTCGCCGCGGGGCGGAGCAAACCGGGTACTGGCTTCCACCGTTG - UNI27552 - TGGCCAGAACCCCGTTCCCAGTG

AGAAGCTTCCAGTGCCTGACAGTGTGCTAAGTATGTTCCCCAGCACAGAGGAAGGGCCTGAGGACGACAGTGCAAAGCATGGCGGTCGAATCCGAACCTT

TCCCCATGAGCGGGGCAACTGGGCCACCCACATCTACATACCGT ATGAGGCGAAGGAGGACTTCCGGGATCTGCTTGACGCGTTGCTGCCCCGAGCTCA

GATGTTTGTACCGAGACTGGTACTGATGGAGGAGTTCCACGTCAGCCTGTCCCAGAGCGTGGTTCTCCGTCACCACTGGATCCTCCCCTTTGTGCAGGTG

CTCAAGGACCGCATGGCCTCTTTCCAAAG GTTCTTCTTTACTGCCAACAGGGTAAAGATTTACACCAATCAAGAGAAAACCAG GACCTTCATCGGGCT

GGAGGTCAGTTCAGGGCATGCCCAGTTCCTGGACCTGGTTTCAGAGGTGGACAGAGCCATGAAGGAATTTGACCTTACTACTTTCTACCAG GACCCCTC

ATTTCATGTCAGCCTGGCCTGGTGTGTAGGTGATGCTAGTCTCCAGCTGGAGGGACAGTGCCTGCAGGAACTACAG GAAATCGTGGATGAGTTTGAAGA

CTCTGAGATGCTGTTACGTGTGCTGGCCAACCAGGTCCGCTGCAAGTCCGGGAACAAATTCTTCTCCATGCCTTTGAAGTGAGCCTTGTCCCGTGCCTCT

CCACAAGCCGACTGAGATGGAGGAACTTGCTGCCATCTGTGGGATGCCCCAGCCAGGAGTCCTAATCCCACACTTAGTACTGATCTAGTGGGCTGCTCAC

TCTCTCCTGGTCCTTAGGTTGGTAGGCTGCTACTGTAATGTGCTCATTTCCAGAAATCACCAGTAGAGGGCAGCCCGGACCTCTAATTCTTCCTCCACTT

TCTTAGGAAAGTCAAATGAGCCTGGCTGGGGAGCCCACCCACGCTCAGTCCCCACCGAGGTCTCTCCACTGCAGTAATCTATATTGATGCCCTTGGCCGT

CAACCACTTTTTTAGATCCCTGTGTTCTGACCCACCTGTGTCAGACTGGGGCTTCCGTTGTCTGTCAGCCTCTCTTTAATCTCCTTTATTTATCACCTCG

TCCCTTCATCCCGTCCTGTGCCAGGAGAGGTCATTTCAGGGCCAGGGCACAGGGTGCTAATTTGTGGTCAGCAGCAGTTTTCTTCATTCCTTCCTCCCAC

TTACCCAGCCAGGTGCCTGGGGAGAGCCCAGCAGATGCTTCATTTTGGCTTGGCTATGGCTGCTGGCCAGGCCTCCAACACCCATGACCCCTACTTTCCC

CATCAGCTTTCCCAGAGATGCAAAGAGGCATCTTCCCTCCAGCCAGAGCACCCCTGCCCCTGTTGCTGAGCATTTTTCAAAGTGGGGGTGGGAAGTGGGG

AGAGGGCCAGGGAGGCATTGGAGAATTTATTTTCCATCAAGCTCCTACCAGGGCAAAGAGCCAAACCTTTCTAGTTGTCATGGGGATTTCTAGTGATGGA

TGAAGAAATATTTTTTTACAGTTTTAAATTATGTTCAACAAATAAAATCTGCCTTTTT
Translation
MSSAPLVGYSSSGSEDEAEAVAAGRSKPGTGFHRC - UNI27552 - CGQNPVPSEKLPVPDSVLSMFPSTEEGPEDDSAKHGGRIRTFPHERGNWAT

HIYIPY YEAKEDFRDLLDALLPRAQMFVPRLVLMEEFHVSLSQSVVLRHHWILPFVQVLKDRMASFQR RFFFTANRVKIYTNQEKTR RTFIGLEVSS

GHAQFLDLVSEVDRAMKEFDLTTFYQ DPSFHVSLAWCVGDASLQLEGQCLQELQ EIVDEFEDSEMLLRVLANQVRCKSGNKFFSMPLK

For any suggestions or comments, please send an email to unitrap@crg.es