Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031813 (1110012M11Rik)
Chromosomal location
Chr 8: 74066829 - 74071923 (+)
Description
family with sequence similarity 125, member A Gene [Source:MGI Symbol;Acc:MGI:1920961]
RefSeq_dna
NM_028617 
RefSeq_peptide
NP_082893.1 
MGI
MGI:1920961 
Uniprot/SWISSPROT
Q78HU3 
Human Ortholog
ENSG00000141971 (FAM125A)
Omim not available
UniTrap UNI17871
Vector Insertion
Chr 8: 74069250 - 74069445
Public Clones not available
Private Clones OST434563 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034272
Sequence
GGTCCCTCCGAGGGCTGTAGCTGCCTTCTGAGCTCCCAGGAAGGATGGATCCCGGGACGGACTCGGCGCCGCTTGCTGGCTTGGTTTGGTCGTCGGCCTC

GGCGCCGCCGCCGCCGGGTTTCAGCGCG ATCACCTGCACCGTGGAGGGCGGGACGGCCAGCTTCGGCCGAGGCTTCGCGCAGAAAGCCGGCTACTTCCT

GTGCCTGAGCACGCTGGGCATCCCGGAG AACCCTCAGGACAATGTGGTAGTGGACATGCAGATCGTGATGGACAAGGGCCCACTGCCGTCAGGCTTCTC

TGCAGTCAACGACCCTCAGGATATCA AGGCCTCTGTGTCCAAGAAGAAACGCATGTGTGTGAAGCTGATGCCCCTGGGGACAGCTGACGTGGTTGTGAG

TGACGTGAAGCTGAGTGGGAAGACTAAGACCGTGCCTGGATACCTGCGTGTGGG - UNI17871 - GGACATTGGTGGCTTTGCCATCTGGTGCAAGA

AATCCAAAGCCCCAAGGCCGGTGCCCAAGCCCCGCACGCTCAGCCAGGACATGCGAGGCCTCTCCCTGGACCCACCCAAAGAGCCCAG CAAAGGAAGCC

ACCCAGAGCGGACCCTGTCCAGGCTGGGCTCTCGGGCCTCCACTCTACGGAGGACCGACTCCATCTATGAGGCATCCAGTCTCTATGGCATATCAG CCA

TGGACGGAGTCCCCTTTACCCTGCACCCAAGATTTGAGGGCAAGAGCTGTGGGCCCTTG AACTTGTCTGCTTTTGGGGACCTGACGATCAAATCACTGG

CAGACATTGAGAAGGAG TATAACTATGGCTTCGTGGTGGAGAAGACTGCAGCTGCACGCCTGCCTCCCAGCGTCTCATAGACCAGCCCCAGGTGCCACC

TGGTCGCCTCCTGCCTTGCAGATACTGCTGATTGACACCCAGCCTCTCTGTCCAACTGCTTGCACAAAGGGTCTCTTGCCTGGTGGTGCAGGGGCGGCCT

GGGCAGAGCAGTGGCCTTCTCTCACAGAAGTCTGTGTCTAGAGGCCACATATGCACCAGCAGTAAACGCTACCTGGGACCC
Translation
MDPGTDSAPLAGLVWSSASAPPPPGFSA ITCTVEGGTASFGRGFAQKAGYFLCLSTLGIPE NPQDNVVVDMQIVMDKGPLPSGFSAVNDPQDIK KAS

VSKKKRMCVKLMPLGTADVVVSDVKLSGKTKTVPGYLRVG - UNI17871 - GDIGGFAIWCKKSKAPRPVPKPRTLSQDMRGLSLDPPKEPS SKGS

HPERTLSRLGSRASTLRRTDSIYEASSLYGISA AMDGVPFTLHPRFEGKSCGPL NLSAFGDLTIKSLADIEKE YNYGFVVEKTAAARLPPSVS

For any suggestions or comments, please send an email to unitrap@crg.es