Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031816 (Mthfsd)
Chromosomal location
Chr 8: 123621457 - 123632218 (-)
Description
methenyltetrahydrofolate synthetase domain containing Gene [Source:MGI Symbol;Acc:MGI:2679252]
RefSeq_dna
NM_172761 
RefSeq_peptide
NP_766349.1 
MGI
MGI:2679252 
Uniprot/SWISSPROT
Q3URQ7 
Human Ortholog
ENSG00000103248 (MTHFSD)
Omim not available
UniTrap UNI26228
Vector Insertion
Chr 8: 123630769 - 123630874
Public Clones not available
Private Clones OST129580 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31938
Vector Insertion
Chr 8: 123630769 - 123632208
Public Clones IST13600B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047282
Sequence
GGTGACGTGTTAGCCATGGAGACCCAGGAGGGTGAGGAAGACCGAGGGTGATGGGGAAACCGAGGCTGGGACGGCGCGGTTGTTCCCGTGGTCCGCATGC

GTGGGGGAGGACGCGGCTCGGCCTG - UNI26228 - - UNI31938 - GTGTCTCCAAACAAAGCATACGTGAACGGATTTGGGACTACATGGAAT

CCCATGATATAGCTGACTTTCCCCGACCCGTTCATCACAGGATCCCCAACTTCAAG - UNI26228 - - UNI31938 - GGTGCTGCTCAGGCTGC

GGGGCACCTCCCACACCTGCAAGCTTTCCATGTGGCCAGAACCATTAAAGTCAACCCGGACGCTCCTCAGAGAAACGCCCGCTTCCTGGTGCTGGAG AG

CAAAAAAACACTGCTGGTCCCAACACCACGACTGCGAACAGGGCTGTTTAACAAGATCACGCCACCCCCTGGAGCCACCAAAGACATTCTGAGGAAATGT

GCCACCTCCCAG GGTGTGCGGAATTTCAGCGTCCCAGTGGGCTTGGATTCCAGTGTTCTTGTGGATCTAGTTGTGGTGGGATCTGTTGCTGTGTCTGAG

AAAG GCTGGCGAATTGGGAAAGGGGAAGGCTATGCTGATCTTGAATACGCCATGATGGTGTCAATGGGAGCCGTCCACAAGGGGACACCGGTTGTCACA

ATTGTCCACGACTGCCAG GTCGTAGACATCCCCGAGGCTCTTGTGGAGGACCACGACCTCACAGTTGACTACATCCTCACTCCCACCAGGGTCATCACT

ACAGGCTGTGCACGCCCAAAGCCAACGGGCATCATGTGGTCCAAG GTCAGCTGTGAGATGCTTACGAAAATCCCAGTGCTCAGGAACCTCCGGGAGAGA

GAGAAACAGGCTGGGAAGGATGTCACTCTCCGGGACGAGCCTGGCAGCCAGCAGCCAGCTCCAGGCCCCATCAGGAGACCCCAGGATAGACCACAAACAG

GTTCTCGAGGAGGGTCCCGTAGTCCCCTGCAGGGGGCGGACACCCAACTAGCTGCCACTGTGTGTGTGGGAAACCTGCCCTTCACTACTCGTGTGCGTGA

GCTGAAGAGAGTCCTCCAGGAGCTGGGGGTGGTGCCCCTGAGGCTTACCTGGCAGGGGCCACAGCACAGGGCAGTTCTACACTATACAGACTCAGCTGCT

GCCCAGCAGGCCGCCTCTCTCCTACAGGGCCTACGTCTGGGTGCCAACGCCTTGAGGGTGTCACTGGGGCAGCAGAGGGATATGTGACCTGGTGAGTAAC

CCCCAGCAGAGGAGTAGCGCCCTTTCTGCTGCTGGGATGTGTCTGCCGTGTGACAGTTTGCCGTGTGACAGTTTGCCATTGGTGATGACCGGCTGCCGTG

TGAGGCACCTGCTCTGTTCTTCCTGGGAAGGGGCCATGCTTCCCTAATGGGCAGGGATGACGGCGAGCAGCCCATCTCGACACCCAGGATGCTGTGAGCT

CTGGCCCATTCCTGGTCTGGTTCTTGTGAAATCCACGTGAGGTTCTCTGGGTGCAGAAGGTTCAGGGACAGAGCAGTCCAGACAAGAGGTAGACAATGGA

GACCTGTTTCAGGGTGTTCAAGGAGAGCGGAGGCCTGCAGAGAAGAGGCCGTCTCGGGGATCAAGGGCATGTGGCCGAGCAGGGTGTCCTTACGACCACT

GGGAACCCACTTAGCAGAACAGGAGCGGGGAGGGCGGGCTTCTGCATCCAGAGAACACAAACTTGGAGCTCTGTTCCTGGAGACGCTGCATTGTGAGCAT

GCGTGATGGCTGCTACCCAGGCAGCTTAGTCATGCCATCTCTCAGGTGAACATGGCGGCTGCCTGTGTGCTTTCAGAAGCACTTGTGCCGTTGAGCCTAA

GGAAAAACAAGCATTAGGTGGAGGGTTTGTCCTGTTCAAACTGCACACCTGGGCAGTTTCTTGTTTTTACCAATGGGTCTTCCACAGCGTCTATTAGCAT

TGTCCTTTGTCCCAAAAGGGCAGGCCTCGCTCATATTAAAGGAAAAGAGCTTGTGACAC
Translation
 - UNI26228 - - UNI31938 - MESHDIADFPRPVHHRIPNFK - UNI26228 - - UNI31938 - GAAQAAGHLPHLQAFHVARTIKVNP

DAPQRNARFLVLE SKKTLLVPTPRLRTGLFNKITPPPGATKDILRKCATSQ GVRNFSVPVGLDSSVLVDLVVVGSVAVSEKG GWRIGKGEGYADLEY

AMMVSMGAVHKGTPVVTIVHDCQ VVDIPEALVEDHDLTVDYILTPTRVITTGCARPKPTGIMWSK VSCEMLTKIPVLRNLREREKQAGKDVTLRDEPG

SQQPAPGPIRRPQDRPQTGSRGGSRSPLQGADTQLAATVCVGNLPFTTRVRELKRVLQELGVVPLRLTWQGPQHRAVLHYTDSAAAQQAASLLQGLRLGA

NALRVSLGQQRDM
Transcript ENSMUST00000116414
Sequence
AGCCATGGAGACCCAGGAGG - UNI26228 - - UNI31938 - GTGTCTCCAAACAAAGCATACGTGAACGGATTTGGGACTACATGGAATCCCAT

GATATAGCTGACTTTCCCCGACCCGTTCATCACAGGATCCCCAACTTCAAG - UNI26228 - - UNI31938 - GGTGCTGCTCAGGCTGCGGGGC

ACCTCCCACACCTGCAAGCTTTCCATGTGGCCAGAACCATTAAAGTCAACCCGGACGCTCCTCAGAGAAACGCCCGCTTCCTGGTGCTGGAG AGCAAAA

AAACACTGCTGGTCCCAACACCACGACTGCGAACAGGGCTGTTTAACAAGATCACGCCACCCCCTGGAGCCACCAAAGACATTCTGAGGAAATGTGCCAC

CTCCCAG GGTGTGCGGAATTTCAGCGTCCCAGTGGGCTTGGATTCCAGTGTTCTTGTGGATCTAGTTGTGGTGGGATCTGTTGCTGTGTCTGAGAAAG 

GCTGGCGAATTGGGAAAGGGGAAGGCTATGCTGATCTTGAATACGCCATGATGGTGTCAATGGGAGCCGTCCACAAGGGGACACCGGTTGTCACAATTGT

CCACGACTGCCAG GTCGTAGACATCCCCGAGGCTCTTGTGGAGGACCACGACCTCACAGTTGACTACATCCTCACTCCCACCAGGGTCATCACTACAGG

CTGTGCACGCCCAAAGCCAACGGGCATCATGTGGTCCAAG GTCAGCTGTGAGATGCTTACGAAAATCCCAGTGCTCAGGAACCTCCGGGAGAGAGAGAA

ACAGGCTGGGAAGGATGTCACTCTCCGGGACGAGCCTGGCAGCCAGCAGCCAGCTCCAGGCCCCATCAGGAGACCCCAGGATAGACCACAAACAGGTTCT

CGAGGAGGGTCCCGTAGTCCCCTGCAGGGGGCGGACACCCAACTAGCTGCCACTGTGTGTGTGGGAAACCTGCCCTTCACTACTCGTGTGCGTGAGCTGA

AGAGAGTCCTCCAGGAGCTGGGGGTGGTGCCCCTGAGGCTTACCTGGCAGGGGCCACAGCACAGGGCAGTTCTACACTATACAGACTCAGCTGCTGCCCA

GCAGGCCGCCTCTCTCCTACAGGGCCTACGTCTGGGTGCCAACGCCTTGAGGGTGTCACTGGGGCAGCAGAGGGATATGTGACCTG GACTCAGCCTTGG

AAAACGGCTAATTCAGTAACCAGCGCTTCCAAGCTGTCAGAGGTGCCATGAGGAGTGACTGAGGGACGCAGGCTCAGGCTGTGCTGGCCTCTGTCCTGGC

CTGCGCCCCCTCCCACTCCTGCCCACCAGACACTGTCCACCCCACTCTCACCTGCTCAGCTTTCCTCGGGGGTTCCGCCTGCATTTGCACCCTTGCCTTC

TTATCTTCTTACCATTGATGTCCCAGTGGGACAGCGCCTGCAGTTTAGCAGGATGGAGCTGTCTGTTCTTCCTGCTGCAGACCAGCGGGGCATGAGCAAC

TCAGGAAATCCATGTTACGTGAGCCAGAATAATCCAGATGCATTGACACACAGTCT
Translation
 - UNI26228 - - UNI31938 - MESHDIADFPRPVHHRIPNFK - UNI26228 - - UNI31938 - GAAQAAGHLPHLQAFHVARTIKVNP

DAPQRNARFLVLE SKKTLLVPTPRLRTGLFNKITPPPGATKDILRKCATSQ GVRNFSVPVGLDSSVLVDLVVVGSVAVSEKG GWRIGKGEGYADLEY

AMMVSMGAVHKGTPVVTIVHDCQ VVDIPEALVEDHDLTVDYILTPTRVITTGCARPKPTGIMWSK VSCEMLTKIPVLRNLREREKQAGKDVTLRDEPG

SQQPAPGPIRRPQDRPQTGSRGGSRSPLQGADTQLAATVCVGNLPFTTRVRELKRVLQELGVVPLRLTWQGPQHRAVLHYTDSAAAQQAASLLQGLRLGA

NALRVSLGQQRDM 
Transcript ENSMUST00000116415
Sequence
AGCCATGGAGACCCAGGAGG - UNI26228 - - UNI31938 - GTGTCTCCAAACAAAGCATACGTGAACGGATTTGGGACTACATGGAATCCCAT

GATATAGCTGACTTTCCCCGACCCGTTCATCACAGGATCCCCAACTTCAAG - UNI26228 - - UNI31938 - GGTGCTGCTCAGGCTGCGGGGC

ACCTCCCACACCTGCAAGCTTTCCATGTGGCCAGAACCATTAAAGTCAACCCGGACGCTCCTCAGAGAAACGCCCGCTTCCTGGTGCTGGAG AGCAAAA

AAACACTGCTGGTCCCAACACCACGACTGCGAACAGGGCTGTTTAACAAGATCACGCCACCCCCTGGAGCCACCAAAGACATTCTGAGGAAATGTGCCAC

CTCCCAG GGTGTGCGGAATTTCAGCGTCCCAGTGGGCTTGGATTCCAGTGTTCTTGTGGATCTAGTTGTGGTGGGATCTGTTGCTGTGTCTGAGAAAG 

GCTGGCGAATTGGGAAAGGGGAAGGCTATGCTGATCTTGAATACGCCATGATGGTGTCAATGGGAGCCGTCCACAAGGGGACACCGGTTGTCACAATTGT

CCACGACTGCCAG GTCGTAGACATCCCCGAGGCTCTTGTGGAGGACCACGACCTCACAGTTGACTACATCCTCACTCCCACCAGGGTCATCACTACAGG

CTGTGCACGCCCAAAGCCAACGGGCATCATGTGGTCCAAG GTCAGCTGTGAGATGCTTACGAAAATCCCAGTGCTCAGGAACCTCCGGGAGAGAGAGAA

ACAGGCTGGGAAGGATGTCACTCTCCGGGACGAGCCTGGCAGCCAGCAGCCAGCTCCAGGCCCCATCAGGAGACCCCAGGATAGACCACAAACAGGTTCT

CGAGGAGGGTCCCGTAGTCCCCTGCAGGGGGCGGACACCCAACTAGCTGCCACTGTGTGTGTGGGAAACCTGCCCTTCACTACTCGTGTGCGTGAGCTGA

AGAGAGTCCTCCAGGAGCTGGGGGTGGTGCCCCTGAGGCTTACCTGGCAGGGGCCACAGCACAGGGCAGTTCTACACTATACAGACTCAGCTGCTGCCCA

GCAGGCCGCCTCTCTCCTACAGGGCCTACGTCTGGGTGCCAACGCCTTGAGGGTGTCACTGGGGCAGCAGAGGGATATGTGACCTG GACTCAGCCTTGG

AAAACGGCTAATTCAGTAACCAGCGCTTCCAAGCTGTCAGAGGTGCCATGAGGAGTGACTGAGGGACGCAGGCTCAGGCTGTGCTGGCCTCTGTCCTGGC

CTGCGCCCCCTCCCACTCCTGCCCACCAGACACTGTCCACCCCACTCTCACCTGCTCAGCTTTCCTCGGGGGTTCCGCCTGCATTTGCACCCTTGCCTTC

TTATCTTCTTACCATTGATGTCCCAGTGGGACAGCGCCTGCAGTTTAGCAGGATGGAGCTGTCTGTTCTTCCTGCTGCAGACCAGCGGGGCATGAGCAAC

TCAGGAAATCCATGTTACGTGAGCCAGAATAATCCAGATGCATTGACACACAGTCT
Translation
METQEG - UNI26228 - - UNI31938 - GVSKQSIRERIWDYMESHDIADFPRPVHHRIPNFK - UNI26228 - - UNI31938 - GAAQA

AGHLPHLQAFHVARTIKVNPDAPQRNARFLVLE SKKTLLVPTPRLRTGLFNKITPPPGATKDILRKCATSQ GVRNFSVPVGLDSSVLVDLVVVGSVAV

SEKG GWRIGKGEGYADLEYAMMVSMGAVHKGTPVVTIVHDCQ VVDIPEALVEDHDLTVDYILTPTRVITTGCARPKPTGIMWSK VSCEMLTKIPVLR

NLREREKQAGKDVTLRDEPGSQQPAPGPIRRPQDRPQTGSRGGSRSPLQGADTQLAATVCVGNLPFTTRVRELKRVLQELGVVPLRLTWQGPQHRAVLHY

TDSAAAQQAASLLQGLRLGANALRVSLGQQRDM 

For any suggestions or comments, please send an email to unitrap@crg.es