Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031820 (5430437P03Rik)
Chromosomal location
Chr 8: 73920760 - 73928448 (+)
Description
RIKEN cDNA 5430437P03 gene Gene [Source:MGI Symbol;Acc:MGI:1915501]
RefSeq_dna
NM_026636 
RefSeq_peptide
NP_080912.1 
MGI
MGI:1915501 
Uniprot/SWISSPROT
Q3UI43 
Uniprot/SPTREMBL
Q9CTJ4 
Human Ortholog
ENSG00000105393 (C19orf62)
Omim not available
UniTrap UNI35567
Vector Insertion
Chr 8: 73920920 - 73921577
Public Clones (ggtc) IST14153D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28290
Vector Insertion
Chr 8: 73921925 - 73922290
Public Clones (ggtc)
Private Clones OST34868 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000002473
Sequence
AGCGCCGCACAAACTTCCGGCCAGGAAGATGGCGGCTTCCTAGAGTCCTGATTGACTGGCCGCGGTGCCCAGGCTACAGAGTGGAACCTGCGGCACTGTG

AACGCGCGTGAGCTTTGTGTCGCCGTGGTCTAACTTCGACCCGGATTGCTGTAGCTCCAG - UNI35567 - GCAGGATCCTGGCTTCCACTATCCCC

CCTTCATCTAACCACTCGGGAACCATGGAGGTGGCAGAGGCGAACAGCCCCACGGAGGAGGAGGAAGAGGAGGAAGAAGAAGGAGAGGAGACGATATCAG

AGCCCAGGCCTCACACTCGATCCAATCCAGAGGGGGCTGAGGACCGGGCCCTGGGAGCTCAAGCCAGTGTGGGCAGCCGCAGCGAGGGCGAGGGTGAGGC

AGCCACTGCAGATGGCGGGGCAGCCAGTGTCCCAGGAGCCGGGCCTAAGCCCTGGCAAGTACCAGCATCAGCATCTGAGGTCCAGATTCGAACACCAAGG

GTCAACTGTCCAGAGAAGGTG - UNI28290 - ATCATCTGTCTGGATCTTTCGGAGGAGATGTCTGTGCCAAAGCTGGAGTCCTTTAATGG CTCTA

GGACAAACGCCCTGAATGTGTCTCAGAAGATGGTTGAGATGTTTGTTCGCACAAAGCACAAGATTGACAAGAGCCACGAATTTGCACTGGTTGTAGTGAA

TGACGACTCCGCCTGG CTGTCTGGCCTGACCTCTGACCCACGTGAGCTCTGCAGCTGCCTGTATGACCTGGAGACGGCGTCCTGCTCCACCTTCA ATT

TGGAAGGCCTCTTCAGCCTCAT CCAGCAGAAGACCGAGCTGCCAGTCACAGAGAATGTGCAAACCATCCCACCCCCCTATGTTGTGCGCACCATCCTGG

TCTACAGCCGCCCACCCTGCCAGCCCCAGTTTTCCCTGACTGAGCCCATGAAG AAGATGTTCCAGTGTCCCTACTTCTTCTTCGACATCGTTTATATCC

ACAATGGCACTGAGGAGAAGGAAGAGGATATGAGCTGGAAG GACATGTTTGCCTTCATGGGTAGCCTGGACACCAAGGGCGCCAGCTACAAGTATGAGG

TAGCACTTGCTGGTCCTGCCCTGGAGCTGCACAATTGCATGGCCAAGTTGCTGGCCCACCCGCTGCAAAGACCCTGCCAGACCCACGCGAGCTACAGCCT

GCTGGAGGAGGACGAGGAGGCTGGAGAAGAGGAAGCCACTGTGTGAACTATGACATGTGACATCTCCGCACCCTCCTATGAGGAGAGCGCAGGCACACTA

TTATTGGCCCATGCTCAATCCCACTCTGTCCACTGTAAATTCATTCTTCCTGGGACTATTTTTGTCACCGGAATAAAAATCTGAGGTCCCTGAGCCC
Translation
 - UNI35567 - MEVAEANSPTEEEEEEEEEGEETISEPRPHTRSNPEGAEDRALGAQASVGSRSEGEGEAATADGGAASVPGAGPKPWQVPASASEV

QIRTPRVNCPEKV - UNI28290 - IICLDLSEEMSVPKLESFNG GSRTNALNVSQKMVEMFVRTKHKIDKSHEFALVVVNDDSAW LSGLTSDPRE

LCSCLYDLETASCSTFN NLEGLFSLI IQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPMK KMFQCPYFFFDIVYIHNGTEEKEEDMS

WK DMFAFMGSLDTKGASYKYEVALAGPALELHNCMAKLLAHPLQRPCQTHASYSLLEEDEEAGEEEATV

For any suggestions or comments, please send an email to unitrap@crg.es