Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031822 (Gse1)
Chromosomal location
Chr 8: 123012766 - 123105276 (+)
Description
genetic suppressor element 1 Gene [Source:MGI (curated);Acc:Gse1-002]
RefSeq_peptide
NP_941073.1 
UniGene
Mm.444335 Mm.334856 
MGI
MGI:1098275 
Uniprot/SWISSPROT
Q3U3C9 
Human Ortholog
ENSG00000131149 (KIAA0182)
Omim not available
UniTrap UNI2407
Vector Insertion
Chr 8: 123013052 - 123059756
Public Clones CH0744 (sanger) AX0565 (sanger) AC0554 (sanger) AX0349 (sanger)
(sanger) AB0216 (sanger) AX0900 (sanger) D065B10 (ggtc) 3SD112A09 (ggtc)
PST882-1 (escells) IST14637G8 (tigm) IST12369B8 (tigm) IST14286H8 (tigm)
IST14245A6 (tigm) IST14964D10 (tigm) IST11585C5 (tigm) IST10490B7 (tigm)
IST12384H6 (tigm) IST11765H4 (tigm) IST11587A2 (tigm) IST10211C9 (tigm)
IST12515C5 (tigm) IST12367F7 (tigm) IST14183C7 (tigm) IST11571A1 (tigm)
IST11856C3 (tigm) IST11764F8 (tigm) IST14147H6 (tigm) IST10230D5 (tigm)
IST14415F5 (tigm) IST14033F11 (tigm) IST14221H12 (tigm) IST13036B10 (tigm)
IST10922C9 (tigm) IST12599D9HMF1 (tigm) IST12581G3 (tigm) IST11380F7 (tigm)
IST12683D8 (tigm) IST11241A3 (tigm) IST12782C7 (tigm) IST10900D10 (tigm)
IST10569D12 (tigm) IST10211B9 (tigm) IST13655A10 (tigm) IST14968G3 (tigm)
IST11513H7 (tigm) IST12668H8 (tigm) IST10401D1 (tigm) IST14829F3 (tigm)
IST13434E7 (tigm) IST11262G5 (tigm) IST14802A12 (tigm) IST14883D1 (tigm)
IST14188B9 (tigm) IST14836H4 (tigm) IST14960H8 (tigm) IST11816E12 (tigm)
IST12369C8 (tigm) IST10548B11 (tigm) IST14190H5 (tigm) IST14790G4 (tigm)
IST13795C3 (tigm) IST10750F9 (tigm) IST11463B3 (tigm) IST11585B5 (tigm)
IST11024C8 (tigm) IST13547B8 (tigm) IST14222H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30070
Vector Insertion
Chr 8: 123059855 - 123061328
Public Clones D128H01 (ggtc) D034A06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17018
Vector Insertion
Chr 8: 123061463 - 123077483
Public Clones (sanger) P151B10 (ggtc) 3SE171E11 (ggtc) IST14697E6 (tigm) IST13016G6 (tigm)
Private Clones OST450788 (lexicon) OST403467 (lexicon) OST371639 (lexicon) OST290774 (lexicon)
OST283572 (lexicon) OST238945 (lexicon) OST135505 (lexicon) OST99295 (lexicon)
OST43680 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI299
Vector Insertion
Chr 8: 123077483 - 123077703
Public Clones GC0488 (tigem) CF0685 (sanger) YHC065 (baygenomics) XH585 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23735
Vector Insertion
Chr 8: 123077703 - 123086525
Public Clones IST14878E5 (tigm)
Private Clones OST246435 (lexicon) OST45441 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8285
Vector Insertion
Chr 8: 123086726 - 123090267
Public Clones RRF229 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6451
Vector Insertion
Chr 8: 123092384 - 123092951
Public Clones CSA122 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27810
Vector Insertion
Chr 8: 123093277 - 123094616
Public Clones not available
Private Clones OST47497 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1304
Vector Insertion
Chr 8: 123095240 - 123096203
Public Clones DC0300 (sanger) RRB080 (baygenomics) A057F05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5279
Vector Insertion
Chr 8: 123099206 - 123100175
Public Clones YTA596 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120493
Sequence
AAACTTGCGGAGGCCACGCTGCCCCGGGCGACGCGAACTAACGCGTGGACCAAAGGCCGCGCAGCGCGTGTGTGGGGCCAGGGACCCGGTGGCCGCAG -

 UNI299 - - UNI17018 - - UNI30070 - GCATGAGCCATGAGCCCAAGTCCCCTTCCATAGGGATGCTTTCCACGGCGACCAGGACCACCGC

CACCGTCAACCCCCTCACCCCCTCGCCACTCAATGGCGCCCTGGTGCCCACCGGTAGCCCGGCCACCAGCAGTACGCTGTCGGCCCAGGCCGCTCCATCC

TCCAGCTTTGCTGCCGCACTGCGCAAGCTCGCCAAACAGGCAGAGGAGCCCAGAG - UNI299 - - UNI23735 - GGTCCTCACTGAGCAGCGAG

TCATCTCCAGTGTCCTCTCCAGCCACCAACCATAGCTCTCCAGCTAGCACGCCCAAACGAGTGCCCATGGGCCCCATCATCGTCCCCCCCGGGGGTCACA

GTGTCCCCAGCACTCCCCCAGTGGTCACTATTGCCCCCACTAAAACCGTCAATGGAGTCTGGAGAAGCGAGAGCCGCCAG - UNI8285 - GACTCTG

GCTCACGAGGCAGCAGCAGTGGTCGGGAGCGCCTATTGGTGGAGCCACCTCTCGCCCAGGAAAAGGCTGCGGGCCCCGCCATCCCCTCCCACCTACTCAG

CACCCCGTACCCCTTTGGCCTTTCCCCCGGCTCAGTTGTACAGGACTCCCGCTTCCAACCACTCAA CCTCCAGCGGCCTGTGCACCATGTGGTGCCCCC

CAGCACGGTGACTGAGGACTACTTGAGAAGCTTCCGGCCCTACCACACTGCTGAAGACTTACGCATGTCCTCCTTGCCTCCGCTTGGCCTGGACCCAGCC

ACCGCCGCAGCCTACTATCACCCCAGCTACCTGGCCCCACACCCATTCCCCCACCCGGCCTTCAG GATGGATGACTCCTATTGCCTGTCAGCCTTAAGG

TCTCCGTTCTACCCCATCCCCACCCCTGGCTCCCTGCCTCCACTGCATCCGTCGGCGATGCACCTGCATCTCTCCGGCGTACGGTATCCTCCTGAGCTCT

CCCACTCGTCCCTGGCGGCGCTACACTCGGAGCGGATGTCCAGCCTCAGTGCAGAGAG GTTGCAAATGGACGAGGAACTGCGGCGGGAGAGAGAGCGAG

AGCGGGAACGGGAACGGGAGGCCGACCGGGAGCGGGAGAAGGAGCGGGAGCGGGAGCAGCGGGAGAAGGAGCGGGAGAAGGAGCTGGAGCGCGAGCGGGA

GAAGGAACGGGAGCGCGAGCTGGAGCGGCAGCGGGAGCAGCGGGCGAGGGAGAAGGAGCTGCTGGCTGCCAAGGCCTTAGAGCCCACCACCTTCCTGCCT

GTGGCCGAGCTGCACGGACTCCGAGGTCACAGCACGGAGGAGCGGCCCAAGCCCTCGGAGCAGCTGACCCCAACCCGAGCAG - UNI6451 - AGAAG

CTGAAGGACGTGGGCTTGCAGGCGCCCAAGCCCGTGCAGCACCCTCTGCACCCAGTGCCTGCCCCACACCACACGGTGCCCAGCCTCATCTCCAGCCACG

GCATCTTCTCTCTGCCTGGAAGCAGCGCCACCACCGCCCTGCTGATCCAGCGCACCAACGAGGAGGAGAAGTGGCTGGCACGGCAGCGCCGCCTGCGGCA

GGAGAAGGAAGACCGCCAGTCCCAGGTGTCCGAGTTCCGGCAGCAGGTCCTGGAGCAGCACCTAGACCTGGGCCGGCCCCTGGTGCCCACAGAGGCGGAG

CACAGGCCCGAGAGCACCAG - UNI27810 - GCCAGGAACAAACCGGCATGAGCAGGGCAGCCGTGAACCCCCACAGCACTTTGGTGGCCCTCCACC

CCTCATCTCACCCAAGCCCCAGCAGCACACCGTACCCACAGCCCTCTGGAACCCAGTGTCTCTGATGGACAATGCTCTGGAGACGCGGCGGGCCGAGAGC

CACTCTCTGCATAGCCACCCGACTGCTTTTGAGCCCAGCCGCCAGGCCGCCGTGCCACTGGTGAAGGTGGAGCGAGTTTATTGCTCAGAGAAGGCAGAGG

AGCCCCGGAAGCGTGAGGCCACACCACTGGACAAATACCAGCCACCACCACCACCACCACCACCGCGGGAGGCAGGAAGTCTGGAGCCTCAGACCTTTCC

CCACGGACCTGGGCCTTTCCTTACTGAACTTGAAAAGTCAACACAGACCATCTTGGGCCAGCAGCGGCCCTCTCTTTCCCAGGCAACCTCCTTCGGGGAG

CTCAGTGGGCCTCTGAAACCAGGCTCTCCGTACTGCCACCCCACAGCGAGGGGCCCCGATCCAGCCTACATCTACGATGAGTTTCTTCAGCAGCGACGGA

AGCTGGTCAGCAAACTGGACCTGGAGGAACGCAGGCGGCGCGAGGCCCAGGAGAAAG - UNI1304 - GGTACTACTACGACCTCGATGACTCGTACG

ACGAGAGTGACGAGGAGGAGGTCAGGGCACACCTCCGCTGTGTGGCTGAGCAGCCGCCCCTCAAACTGGACACATCCTCGGAG AAGCTAGAGTTCTTGC

AACTTTTTGGCTTGACCACCCAACAGCAGAAGGAGGAACTGGTGGCGCAGAAGCGCCGGAAGCGGAGGCGGATGCTCAGAGAGAGAAGCCCGTCGCCACC

TGCCGTTCAGTGCAAGCGACAGACGCCTTCCCCCAGGCTGGCTCTGTCCACCCGCTACAGCCCCGACGAGATGAACAACAGCCCCAACTTTGAGGAGAAG

AGGAAGTTCCTGACCTTCTTCAACTTGACGCACATCAGTGCGGAGAAGAGGAAAG ACAAAGAGAGGCTTGTTGAAATGCTCCGAGCCATGAAGCAGAGA

GCACTGTCCGCAGCAGACTCAGTGACAAACTCTTCGAGGGACAGTCCTCCCGTCTCCCTGAGTG AACCAGCCACACAGCCAGCTCCTCTAGAGACGGAT

CAGCCTGTCGGGGTCCCTGCCTCCTTGTCAGATGTCCCAAAGACCACGGAGACCGGGAGACTGGAACAGCTCCGGCCCCAGGAGCTCTTGAGAGTCCAGG

AGCCGGCTCCTCCCAGTGGTGAGAAGGCCAGGCTGAGCGAGGCCCCTGGTGGCAAGAAGAGCCTGAGCATGCTCCATTACCTCCGGGGCGCCGCGCCCAA

GGACATTCCTGTGCCGTTGTCTCACAGCATCAACGGGAAGAGCAAGCCCTGGGAGCCTTTCGTGGCCGAAGAGTTTGCACATCAATTCCACGAGTCCGTG

CTGCAGTCCACACAGAAGGCTCTGCAGAAGCATAAAG - UNI5279 - GGAACTCTGCTTTGCTATCTGCAGAGCAGAGCCACAAAGTCGACACGGCA

ATCCACTACAACATTCCCGAGCTGCAGTCCTCCAGCAGGGTCCCCTTGCCCCAGCACAATGGACAACAGGAGCCTCCAATGGGGAGGAAGGGCCCTCCTA

TGCAGGAGGCGGACCAGGACTCTGAGGAGGACTCTGAGGAGGACAGCGAGGAGGAAGCTGAGGAAGCCCCGAGGCGCCAGTGGCAAGGGATTGAGGCAAT

CTTTGAAGCTTACCAGGAACACATAGAAG AGCAAAACCTGGAGCGGCAGGTGCTGCAGACGCAGTGCCGGCGGTTGGAGGCGCAGAACTACAGCCTCAG

CCTGACTGCGGAGCAGCTGTCTCACAGCATGGCG GAGCTTCGGAGTCAGAAACAGAAGATGGTCTCTGAGCGGGAGCGGCTCCAGGCGGAGCTGGACCA

CTTGCGGAAGTGCCTTGCCTTGCCCACCATGCACTGGCCTAGGGGCTACTTTAAGGGATATCCGAGGTGACGGTTTCCCTTGCACTAGGCTGAACCTATA

GTATAGAAATATTATCTATTTTATTACCTTGAATATTTAATATTTTTCACTGGGAGGTTTGAAGCTTACAAATTGAGAACGTGCCATGCATGAAACAAAG

GGTTCCAGGCTCCAGAGAGGAGATCACCTCGACGCCAATGTCACCGAGGCACCTGTCTCAGCTAGGACTCAGTTTCTCTTTCTGAGGTCGGCGTTATTTC

CTCTCTCCCCCCACGTCATCCTCCTCCGACACTGACGTCCACCGTGCATGTGGCTGAGGGAGAGAGCCAGCTGGTTGTTTCTGGTATAGCTGTGCCACGA

GAGCCCAGCTTGCTGTTGCTGCGGCCCTGGGGTTTAACCTCTTCCTGCCAGGAGCGGGACTAATGCGCCGGGAAGGCTGGGTGCGTACAAGCAAAGGGCT

CCCCATCAGTCCCGTCCGTCTGTCGCCTTCCCGCAAGCGTCATCATCGAAGCCACTGCTCCTGGGAGCACACAAGCTTCTCCCTGGAACAGCTCTTAGGA

AAAGAGGCAAACCCACACCCAAAAGTACCTTGTTTTCCTTGGGGAAGATGCGTGGAGCTGTCCACAGATAGCCTACCCACTGGATTGCTACCGCCGTGTG

TGGTGTTTTCATACAAACGTACGTTTTGAGAGAAAAGTCAAAGGTGCTTCAGCCTTGTACTGTGTATATATTAAAAAAAAAGTTTTGTATGTTTTTATTA

CTTTAATTATTGTTATAAAAAGCCTGCCATTTTTAATATGTGGTTTGGGGAATTTTGTTTGTTTTTCCTGTTTGGGGGTTTTCTTTGGTTTTTTTGTTTG

TTTGTTTCTGTTTTTCTGGATTTAAAAAAAAAGAAAACCTTGCTTTT
Translation
 - UNI299 - - UNI17018 - - UNI30070 - MSHEPKSPSIGMLSTATRTTATVNPLTPSPLNGALVPTGSPATSSTLSAQAAPSSSFAAALR

KLAKQAEEPRG - UNI299 - - UNI23735 - GSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPSTPPVVTIAPTKTVNGVWRSE

SRQ - UNI8285 - DSGSRGSSSGRERLLVEPPLAQEKAAGPAIPSHLLSTPYPFGLSPGSVVQDSRFQPLN NLQRPVHHVVPPSTVTEDYLRSFRP

YHTAEDLRMSSLPPLGLDPATAAAYYHPSYLAPHPFPHPAFR RMDDSYCLSALRSPFYPIPTPGSLPPLHPSAMHLHLSGVRYPPELSHSSLAALHSER

MSSLSAER RLQMDEELRREREREREREREADREREKEREREQREKEREKELEREREKERERELERQREQRAREKELLAAKALEPTTFLPVAELHGLRGH

STEERPKPSEQLTPTRAE - UNI6451 - EKLKDVGLQAPKPVQHPLHPVPAPHHTVPSLISSHGIFSLPGSSATTALLIQRTNEEEKWLARQRRLRQ

EKEDRQSQVSEFRQQVLEQHLDLGRPLVPTEAEHRPESTR - UNI27810 - RPGTNRHEQGSREPPQHFGGPPPLISPKPQQHTVPTALWNPVSLMD

NALETRRAESHSLHSHPTAFEPSRQAAVPLVKVERVYCSEKAEEPRKREATPLDKYQPPPPPPPPREAGSLEPQTFPHGPGPFLTELEKSTQTILGQQRP

SLSQATSFGELSGPLKPGSPYCHPTARGPDPAYIYDEFLQQRRKLVSKLDLEERRRREAQEKG - UNI1304 - GYYYDLDDSYDESDEEEVRAHLRC

VAEQPPLKLDTSSE KLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPAVQCKRQTPSPRLALSTRYSPDEMNNSPNFEEKRKFLTFFNLTHIS

AEKRKD DKERLVEMLRAMKQRALSAADSVTNSSRDSPPVSLSE EPATQPAPLETDQPVGVPASLSDVPKTTETGRLEQLRPQELLRVQEPAPPSGEKA

RLSEAPGGKKSLSMLHYLRGAAPKDIPVPLSHSINGKSKPWEPFVAEEFAHQFHESVLQSTQKALQKHKG - UNI5279 - GNSALLSAEQSHKVDTA

IHYNIPELQSSSRVPLPQHNGQQEPPMGRKGPPMQEADQDSEEDSEEDSEEEAEEAPRRQWQGIEAIFEAYQEHIEE EQNLERQVLQTQCRRLEAQNYS

LSLTAEQLSHSMA ELRSQKQKMVSERERLQAELDHLRKCLALPTMHWPRGYFKGYPR
Transcript ENSMUST00000118136
Sequence
GAAGCTCCACCTCCCCGAGCGGCGGAGCCGCCGCCGCACAGCCCCGGGTGAGATAAGCAGTTCAGACAAACCCGGGCGACGGTGGCTCCGGCATGTGTCA

GGAGCGGTGGAGCAGCGGGGCCCTGGCATGAAAG - UNI299 - - UNI17018 - GCATGAGCCATGAGCCCAAGTCCCCTTCCATAGGGATGCTT

TCCACGGCGACCAGGACCACCGCCACCGTCAACCCCCTCACCCCCTCGCCACTCAATGGCGCCCTGGTGCCCACCGGTAGCCCGGCCACCAGCAGTACGC

TGTCGGCCCAGGCCGCTCCATCCTCCAGCTTTGCTGCCGCACTGCGCAAGCTCGCCAAACAGGCAGAGGAGCCCAGAG - UNI299 - - UNI23735

 - GGTCCTCACTGAGCAGCGAGTCATCTCCAGTGTCCTCTCCAGCCACCAACCATAGCTCTCCAGCTAGCACGCCCAAACGAGTGCCCATGGGCCCCAT

CATCGTCCCCCCCGGGGGTCACAGTGTCCCCAGCACTCCCCCAGTGGTCACTATTGCCCCCACTAAAACCGTCAATGGAGTCTGGAGAAGCGAGAGCCGC

CAG - UNI8285 - GACTCTGGCTCACGAGGCAGCAGCAGTGGTCGGGAGCGCCTATTGGTGGAGCCACCTCTCGCCCAGGAAAAGGCTGCGGGCCCC

GCCATCCCCTCCCACCTACTCAGCACCCCGTACCCCTTTGGCCTTTCCCCCGGCTCAGTTGTACAGGACTCCCGCTTCCAACCACTCAA CCTCCAGCGG

CCTGTGCACCATGTGGTGCCCCCCAGCACGGTGACTGAGGACTACTTGAGAAGCTTCCGGCCCTACCACACTGCTGAAGACTTACGCATGTCCTCCTTGC

CTCCGCTTGGCCTGGACCCAGCCACCGCCGCAGCCTACTATCACCCCAGCTACCTGGCCCCACACCCATTCCCCCACCCGGCCTTCAG GATGGATGACT

CCTATTGCCTGTCAGCCTTAAGGTCTCCGTTCTACCCCATCCCCACCCCTGGCTCCCTGCCTCCACTGCATCCGTCGGCGATGCACCTGCATCTCTCCGG

CGTACGGTATCCTCCTGAGCTCTCCCACTCGTCCCTGGCGGCGCTACACTCGGAGCGGATGTCCAGCCTCAGTGCAGAGAG GTTGCAAATGGACGAGGA

ACTGCGGCGGGAGAGAGAGCGAGAGCGGGAACGGGAACGGGAGGCCGACCGGGAGCGGGAGAAGGAGCGGGAGCGGGAGCAGCGGGAGAAGGAGCGGGAG

AAGGAGCTGGAGCGCGAGCGGGAGAAGGAACGGGAGCGCGAGCTGGAGCGGCAGCGGGAGCAGCGGGCGAGGGAGAAGGAGCTGCTGGCTGCCAAGGCCT

TAGAGCCCACCACCTTCCTGCCTGTGGCCGAGCTGCACGGACTCCGAGGTCACAGCACGGAGGAGCGGCCCAAGCCCTCGGAGCAGCTGACCCCAACCCG

AGCAG - UNI6451 - AGAAGCTGAAGGACGTGGGCTTGCAGGCGCCCAAGCCCGTGCAGCACCCTCTGCACCCAGTGCCTGCCCCACACCACACGGT

GCCCAGCCTCATCTCCAGCCACGGCATCTTCTCTCTGCCTGGAAGCAGCGCCACCACCGCCCTGCTGATCCAGCGCACCAACGAGGAGGAGAAGTGGCTG

GCACGGCAGCGCCGCCTGCGGCAGGAGAAGGAAGACCGCCAGTCCCAGGTGTCCGAGTTCCGGCAGCAGGTCCTGGAGCAGCACCTAGACCTGGGCCGGC

CCCTGGTGCCCACAGAGGCGGAGCACAGGCCCGAGAGCACCAG - UNI27810 - GCCAGGAACAAACCGGCATGAGCAGGGCAGCCGTGAACCCCCA

CAGCACTTTGGTGGCCCTCCACCCCTCATCTCACCCAAGCCCCAGCAGCACACCGTACCCACAGCCCTCTGGAACCCAGTGTCTCTGATGGACAATGCTC

TGGAGACGCGGCGGGCCGAGAGCCACTCTCTGCATAGCCACCCGACTGCTTTTGAGCCCAGCCGCCAGGCCGCCGTGCCACTGGTGAAGGTGGAGCGAGT

TTATTGCTCAGAGAAGGCAGAGGAGCCCCGGAAGCGTGAGGCCACACCACTGGACAAATACCAGCCACCACCACCACCACCACCACCGCGGGAGGCAGGA

AGTCTGGAGCCTCAGACCTTTCCCCACGGACCTGGGCCTTTCCTTACTGAACTTGAAAAGTCAACACAGACCATCTTGGGCCAGCAGCGGCCCTCTCTTT

CCCAGGCAACCTCCTTCGGGGAGCTCAGTGGGCCTCTGAAACCAGGCTCTCCGTACTGCCACCCCACAGCGAGGGGCCCCGATCCAGCCTACATCTACGA

TGAGTTTCTTCAGCAGCGACGGAAGCTGGTCAGCAAACTGGACCTGGAGGAACGCAGGCGGCGCGAGGCCCAGGAGAAAG - UNI1304 - GGTACTA

CTACGACCTCGATGACTCGTACGACGAGAGTGACGAGGAGGAGGTCAGGGCACACCTCCGCTGTGTGGCTGAGCAGCCGCCCCTCAAACTGGACACATCC

TCGGAG AAGCTAGAGTTCTTGCAACTTTTTGGCTTGACCACCCAACAGCAGAAGGAGGAACTGGTGGCGCAGAAGCGCCGGAAGCGGAGGCGGATGCTC

AGAGAGAGAAGCCCGTCGCCACCTGCCGTTCAGTGCAAGCGACAGACGCCTTCCCCCAGGCTGGCTCTGTCCACCCGCTACAGCCCCGACGAGATGAACA

ACAGCCCCAACTTTGAGGAGAAGAGGAAGTTCCTGACCTTCTTCAACTTGACGCACATCAGTGCGGAGAAGAGGAAAG ACAAAGAGAGGCTTGTTGAAA

TGCTCCGAGCCATGAAGCAGAGAGCACTGTCCGCAGCAGACTCAGTGACAAACTCTTCGAGGGACAGTCCTCCCGTCTCCCTGAGTG AACCAGCCACAC

AGCCAGCTCCTCTAGAGACGGATCAGCCTGTCGGGGTCCCTGCCTCCTTGTCAGATGTCCCAAAGACCACGGAGACCGGGAGACTGGAACAGCTCCGGCC

CCAGGAGCTCTTGAGAGTCCAGGAGCCGGCTCCTCCCAGTGGTGAGAAGGCCAGGCTGAGCGAGGCCCCTGGTGGCAAGAAGAGCCTGAGCATGCTCCAT

TACCTCCGGGGCGCCGCGCCCAAGGACATTCCTGTGCCGTTGTCTCACAGCATCAACGGGAAGAGCAAGCCCTGGGAGCCTTTCGTGGCCGAAGAGTTTG

CACATCAATTCCACGAGTCCGTGCTGCAGTCCACACAGAAGGCTCTGCAGAAGCATAAAG - UNI5279 - GGAACTCTGCTTTGCTATCTGCAGAGC

AGAGCCACAAAGTCGACACGGCAATCCACTACAACATTCCCGAGCTGCAGTCCTCCAGCAGGGTCCCCTTGCCCCAGCACAATGGACAACAGGAGCCTCC

AATGGGGAGGAAGGGCCCTCCTATGCAGGAGGCGGACCAGGACTCTGAGGAGGACTCTGAGGAGGACAGCGAGGAGGAAGCTGAGGAAGCCCCGAGGCGC

CAGTGGCAAGGGATTGAGGCAATCTTTGAAGCTTACCAGGAACACATAGAAG AGCAAAACCTGGAGCGGCAGGTGCTGCAGACGCAGTGCCGGCGGTTG

GAGGCGCAGAACTACAGCCTCAGCCTGACTGCGGAGCAGCTGTCTCACAGCATGGCG GAGCTTCGGAGTCAGAAACAGAAGATGGTCTCTGAGCGGGAG

CGGCTCCAGGCGGAGCTGGACCACTTGCGGAAGTGCCTTGCCTTGCCCACCATGCACTGGCCTAGGGGCTACTTTAAGGGATATCCGAGGTGACGGTTTC

CCTTGCACTAGGCTGAACCTATAGTATAGAAATATTATCTATTTTATTACCTTGAATATTTAATATTTTTCACTGGGAGGTTTGAAGCTTACAAATTGAG

AACGTGCCATGCATGAAACAAAGGGTTCCAGGCTCCAGAGAGGAGATCACCTCGACGCCAATGTCACCGAGGCACCTGTCTCAGCTAGGACTCAGTTTCT

CTTTCTGAGGTCGGCGTTATTTCCTCTCTCCCCCCACGTCATCCTCCTCCGACACTGACGTCCACCGTGCATGTGGCTGAGGGAGAGAGCCAGCTGGTTG

TTTCTGGTATAGCTGTGCCACGAGAGCCCAGCTTGCTGTTGCTGCGGCCCTGGGGTTTAACCTCTTCCTGCCAGGAGCGGGACTAATGCGCCGGGAAGGC

TGGGTGCGTACAAGCAAAGGGCTCCCCATCAGTCCCGTCCGTCTGTCGCCTTCCCGCAAGCGTCATCATCGAAGCCACTGCTCCTGGGAGCACACAAGCT

TCTCCCTGGAACAGCTCTTAGGAAAAGAGGCAAACCCACACCCAAAAGTACCTTGTTTTCCTTGGGGAAGATGCGTGGAGCTGTCCACAGATAGCCTACC

CACTGGATTGCTACCGCCGTGTGTGGTGTTTTCATACAAACGTACGTTTTGAGAGAAAAGTCAAAGGTGCTTCAGCCTTGTACTGTGTATATATTAAAAA

AAAAGTTTTGTATGTT
Translation
MKG - UNI299 - - UNI17018 - GMSHEPKSPSIGMLSTATRTTATVNPLTPSPLNGALVPTGSPATSSTLSAQAAPSSSFAAALRKLAKQAEEP

RG - UNI299 - - UNI23735 - GSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPSTPPVVTIAPTKTVNGVWRSESRQ - UNI

8285 - DSGSRGSSSGRERLLVEPPLAQEKAAGPAIPSHLLSTPYPFGLSPGSVVQDSRFQPLN NLQRPVHHVVPPSTVTEDYLRSFRPYHTAEDLRM

SSLPPLGLDPATAAAYYHPSYLAPHPFPHPAFR RMDDSYCLSALRSPFYPIPTPGSLPPLHPSAMHLHLSGVRYPPELSHSSLAALHSERMSSLSAER 

RLQMDEELRREREREREREREADREREKEREREQREKEREKELEREREKERERELERQREQRAREKELLAAKALEPTTFLPVAELHGLRGHSTEERPKPS

EQLTPTRAE - UNI6451 - EKLKDVGLQAPKPVQHPLHPVPAPHHTVPSLISSHGIFSLPGSSATTALLIQRTNEEEKWLARQRRLRQEKEDRQSQV

SEFRQQVLEQHLDLGRPLVPTEAEHRPESTR - UNI27810 - RPGTNRHEQGSREPPQHFGGPPPLISPKPQQHTVPTALWNPVSLMDNALETRRAE

SHSLHSHPTAFEPSRQAAVPLVKVERVYCSEKAEEPRKREATPLDKYQPPPPPPPPREAGSLEPQTFPHGPGPFLTELEKSTQTILGQQRPSLSQATSFG

ELSGPLKPGSPYCHPTARGPDPAYIYDEFLQQRRKLVSKLDLEERRRREAQEKG - UNI1304 - GYYYDLDDSYDESDEEEVRAHLRCVAEQPPLKL

DTSSE KLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPAVQCKRQTPSPRLALSTRYSPDEMNNSPNFEEKRKFLTFFNLTHISAEKRKD DK

ERLVEMLRAMKQRALSAADSVTNSSRDSPPVSLSE EPATQPAPLETDQPVGVPASLSDVPKTTETGRLEQLRPQELLRVQEPAPPSGEKARLSEAPGGK

KSLSMLHYLRGAAPKDIPVPLSHSINGKSKPWEPFVAEEFAHQFHESVLQSTQKALQKHKG - UNI5279 - GNSALLSAEQSHKVDTAIHYNIPELQ

SSSRVPLPQHNGQQEPPMGRKGPPMQEADQDSEEDSEEDSEEEAEEAPRRQWQGIEAIFEAYQEHIEE EQNLERQVLQTQCRRLEAQNYSLSLTAEQLS

HSMA ELRSQKQKMVSERERLQAELDHLRKCLALPTMHWPRGYFKGYPR
Transcript ENSMUST00000108938
Sequence
TGCCCGGGCGCTGGACGGAAAGGCAGCCTTTGATCATCTCGGAGAAGGAAAAGGAAAAAACACAAACTGGTTTCTACCCACGGTGCTCCGGGGATCGCTC

TTCTGCTTTTATTTTATTGTTTTGGACATTTTTGAGCGCCGTGGCTTGGACGCTGGTTTTGTTTCATTGCTGGGCTTGATTTTTTTTTTTTTTTCCCCTC

ATTTCCTTCTTCGTCCCTCTCTGGCCACTATGGAATTCTAACCTGAGCCATGTTCGGACTGAAGCCGCCTCTCTATTACTTACCAG - UNI299 - - 

UNI2407 - - UNI17018 - - UNI30070 - GCATGAGCCATGAGCCCAAGTCCCCTTCCATAGGGATGCTTTCCACGGCGACCAGGACCACCGC

CACCGTCAACCCCCTCACCCCCTCGCCACTCAATGGCGCCCTGGTGCCCACCGGTAGCCCGGCCACCAGCAGTACGCTGTCGGCCCAGGCCGCTCCATCC

TCCAGCTTTGCTGCCGCACTGCGCAAGCTCGCCAAACAGGCAGAGGAGCCCAGAG - UNI299 - - UNI23735 - GGTCCTCACTGAGCAGCGAG

TCATCTCCAGTGTCCTCTCCAGCCACCAACCATAGCTCTCCAGCTAGCACGCCCAAACGAGTGCCCATGGGCCCCATCATCGTCCCCCCCGGGGGTCACA

GTGTCCCCAGCACTCCCCCAGTGGTCACTATTGCCCCCACTAAAACCGTCAATGGAGTCTGGAGAAGCGAGAGCCGCCAG - UNI8285 - GACTCTG

GCTCACGAGGCAGCAGCAGTGGTCGGGAGCGCCTATTGGTGGAGCCACCTCTCGCCCAGGAAAAGGCTGCGGGCCCCGCCATCCCCTCCCACCTACTCAG

CACCCCGTACCCCTTTGGCCTTTCCCCCGGCTCAGTTGTACAGGACTCCCGCTTCCAACCACTCAA CCTCCAGCGGCCTGTGCACCATGTGGTGCCCCC

CAGCACGGTGACTGAGGACTACTTGAGAAGCTTCCGGCCCTACCACACTGCTGAAGACTTACGCATGTCCTCCTTGCCTCCGCTTGGCCTGGACCCAGCC

ACCGCCGCAGCCTACTATCACCCCAGCTACCTGGCCCCACACCCATTCCCCCACCCGGCCTTCAG GATGGATGACTCCTATTGCCTGTCAGCCTTAAGG

TCTCCGTTCTACCCCATCCCCACCCCTGGCTCCCTGCCTCCACTGCATCCGTCGGCGATGCACCTGCATCTCTCCGGCGTACGGTATCCTCCTGAGCTCT

CCCACTCGTCCCTGGCGGCGCTACACTCGGAGCGGATGTCCAGCCTCAGTGCAGAGAG GTTGCAAATGGACGAGGAACTGCGGCGGGAGAGAGAGCGAG

AGCGGGAACGGGAACGGGAGGCCGACCGGGAGCGGGAGAAGGAGCGGGAGCGGGAGCAGCGGGAGAAGGAGCGGGAGAAGGAGCTGGAGCGCGAGCGGGA

GAAGGAACGGGAGCGCGAGCTGGAGCGGCAGCGGGAGCAGCGGGCGAGGGAGAAGGAGCTGCTGGCTGCCAAGGCCTTAGAGCCCACCACCTTCCTGCCT

GTGGCCGAGCTGCACGGACTCCGAGGTCACAGCACGGAGGAGCGGCCCAAGCCCTCGGAGCAGCTGACCCCAACCCGAGCAG - UNI6451 - AGAAG

CTGAAGGACGTGGGCTTGCAGGCGCCCAAGCCCGTGCAGCACCCTCTGCACCCAGTGCCTGCCCCACACCACACGGTGCCCAGCCTCATCTCCAGCCACG

GCATCTTCTCTCTGCCTGGAAGCAGCGCCACCACCGCCCTGCTGATCCAGCGCACCAACGAGGAGGAGAAGTGGCTGGCACGGCAGCGCCGCCTGCGGCA

GGAGAAGGAAGACCGCCAGTCCCAGGTGTCCGAGTTCCGGCAGCAGGTCCTGGAGCAGCACCTAGACCTGGGCCGGCCCCTGGTGCCCACAGAGGCGGAG

CACAGGCCCGAGAGCACCAG - UNI27810 - GCCAGGAACAAACCGGCATGAGCAGGGCAGCCGTGAACCCCCACAGCACTTTGGTGGCCCTCCACC

CCTCATCTCACCCAAGCCCCAGCAGCACACCGTACCCACAGCCCTCTGGAACCCAGTGTCTCTGATGGACAATGCTCTGGAGACGCGGCGGGCCGAGAGC

CACTCTCTGCATAGCCACCCGACTGCTTTTGAGCCCAGCCGCCAGGCCGCCGTGCCACTGGTGAAGGTGGAGCGAGTTTATTGCTCAGAGAAGGCAGAGG

AGCCCCGGAAGCGTGAGGCCACACCACTGGACAAATACCAGCCACCACCACCACCACCACCACCGCGGGAGGCAGGAAGTCTGGAGCCTCAGACCTTTCC

CCACGGACCTGGGCCTTTCCTTACTGAACTTGAAAAGTCAACACAGACCATCTTGGGCCAGCAGCGGCCCTCTCTTTCCCAGGCAACCTCCTTCGGGGAG

CTCAGTGGGCCTCTGAAACCAGGCTCTCCGTACTGCCACCCCACAGCGAGGGGCCCCGATCCAGCCTACATCTACGATGAGTTTCTTCAGCAGCGACGGA

AGCTGGTCAGCAAACTGGACCTGGAGGAACGCAGGCGGCGCGAGGCCCAGGAGAAAG - UNI1304 - GGTACTACTACGACCTCGATGACTCGTACG

ACGAGAGTGACGAGGAGGAGGTCAGGGCACACCTCCGCTGTGTGGCTGAGCAGCCGCCCCTCAAACTGGACACATCCTCGGAG AAGCTAGAGTTCTTGC

AACTTTTTGGCTTGACCACCCAACAGCAGAAGGAGGAACTGGTGGCGCAGAAGCGCCGGAAGCGGAGGCGGATGCTCAGAGAGAGAAGCCCGTCGCCACC

TGCCGTTCAGTGCAAGCGACAGACGCCTTCCCCCAGGCTGGCTCTGTCCACCCGCTACAGCCCCGACGAGATGAACAACAGCCCCAACTTTGAGGAGAAG

AGGAAGTTCCTGACCTTCTTCAACTTGACGCACATCAGTGCGGAGAAGAGGAAAG AACCAGCCACACAGCCAGCTCCTCTAGAGACGGATCAGCCTGTC

GGGGTCCCTGCCTCCTTGTCAGATGTCCCAAAGACCACGGAGACCGGGAGACTGGAACAGCTCCGGCCCCAGGAGCTCTTGAGAGTCCAGGAGCCGGCTC

CTCCCAGTGGTGAGAAGGCCAGGCTGAGCGAGGCCCCTGGTGGCAAGAAGAGCCTGAGCATGCTCCATTACCTCCGGGGCGCCGCGCCCAAGGACATTCC

TGTGCCGTTGTCTCACAGCATCAACGGGAAGAGCAAGCCCTGGGAGCCTTTCGTGGCCGAAGAGTTTGCACATCAATTCCACGAGTCCGTGCTGCAGTCC

ACACAGAAGGCTCTGCAGAAGCATAAAG - UNI5279 - GGAACTCTGCTTTGCTATCTGCAGAGCAGAGCCACAAAGTCGACACGGCAATCCACTAC

AACATTCCCGAGCTGCAGTCCTCCAGCAGGGTCCCCTTGCCCCAGCACAATGGACAACAGGAGCCTCCAATGGGGAGGAAGGGCCCTCCTATGCAGGAGG

CGGACCAGGACTCTGAGGAGGACTCTGAGGAGGACAGCGAGGAGGAAGCTGAGGAAGCCCCGAGGCGCCAGTGGCAAGGGATTGAGGCAATCTTTGAAGC

TTACCAGGAACACATAGAAG AGCAAAACCTGGAGCGGCAGGTGCTGCAGACGCAGTGCCGGCGGTTGGAGGCGCAGAACTACAGCCTCAGCCTGACTGC

GGAGCAGCTGTCTCACAGCATGGCG GAGCTTCGGAGTCAGAAACAGAAGATGGTCTCTGAGCGGGAGCGGCTCCAGGCGGAGCTGGACCACTTGCGGAA

GTGCCTTGCCTTGCCCACCATGCACTGGCCTAGGGGCTACTTTAAGGGATATCCGAGGTGACGGTTTCCCTTGCACTAGGCTGAACCTATAGTATAGAAA

TATTATCTATTTTATTACCTTGAATATTTAATATTTTTCACTGGGAGGTTTGAAGCTTACAAATTGAGAACGTGCCATGCATGAAACAAAGGGTTCCAGG

CTCCAGAGAGGAGATCACCTCGACGCCAATGTCACCGAGGCACCTGTCTCAGCTAGGACTCAGTTTCTCTTTCTGAGGTCGGCGTTATTTCCTCTCTCCC

CCCACGTCATCCTCCTCCGACACTGACGTCCACCGTGCATGTGGCTGAGGGAGAGAGCCAGCTGGTTGTTTCTGGTATAGCTGTGCCACGAGAGCCCAGC

TTGCTGTTGCTGCGGCCCTGGGGTTTAACCTCTTCCTGCCAGGAGCGGGACTAATGCGCCGGGAAGGCTGGGTGCGTACAAGCAAAGGGCTCCCCATCAG

TCCCGTCCGTCTGTCGCCTTCCCGCAAGCGTCATCATCGAAGCCACTGCTCCTGGGAGCACACAAGCTTCTCCCTGGAACAGCTCTTAGGAAAAGAGGCA

AACCCACACCCAAAAGTACCTTGTTTTCCTTGGGGAAGATGCGTGGAGCTGTCCACAGATAGCCTACCCACTGGATTGCTACCGCCGTGTGTGGTGTTTT

CATACAAACGTACGTTTTGAGAGAAAAGTCAAAGGTGCTTCAGCCTTGTACTGTGTATATATTAAAAAAAAAGTTTTGTATGTTTTTATTACTTTAATTA

TTGTTATAAAAAGCCTGCCATTTTTAATATGTGGTTTGGGGAATTTTGTTTGTTTTTCCTGTTTGGGGGTTTTCTTTGGTTTTTTTGTTTGTTTGTTTCT

GTTTTTCTGGATTTAAAAAAAAAGAAAACCTTGCTTTTAGTGTTTGTACTGCTGCTGGTCAGAATGTTGTTAACTGCTCAGTTCTAGGAAGCAGGAGAGC

TCGCTTGTGCAGTGTCCCACACAGCAGGGCTGAGGGGCCTAGGGCTGCCTGCTCTCCAAAGCAGATGACCCATGTGCGGCAGGGACTCGGCAAAGCTGTG

AGGAGCTGAGCTCCGGAGACAGGCACAGCTCTGGCAGAAAGCTCAACGCTAAGGGATCTCCTTCCCAGTTTCAGCACTTCAGTCAGGGCTGACCAACTTG

AAAAGAGCCTCCGACTGTCCTCCATCGGACAGGGGAAGAGGAGGCCGAGCCCACCCTTAGCCACCAGGCTCAGTGGCTGTACAGAGCAGCTGGCTGACAT

CTGTCCCTGCTCCACCCCTGCCCCTACCCGCACCCCTCTGGTTCTCAGCAAACTCAGACAAGGCAGTGCCACCAGGCCTGTCAGCAAAGCACCTTCCTCT

GCCCACAGCCAGTCAGAGAAAACGATCCAAAGGAGGGCAGAGGCCGCACACCCTGGGCCGAGTCCTGCCCGACTTCCCAGTTAAATGCTGCTTGTGCCCA

GTGCTGCTTTCCCAAGCTCACCCCACCTCCATGACTAGAAGCTTCTGCAAATCTGCTTGGTAAATGTCTCCTGGGAAAGGCAGAACCCATAACTTAAAGA

CACGCACAGTCCCTTCCATTGTCCCACAGGAGTTCCTCTGGCTGAGTATGCCATCCAGAGCAAGCGATGCCCTCCCAGGTCAGTCTGGGGCACAAGCTGA

GCCGCTGACTAGCAATGCCTACAGCCTTTCCCAATGCCCTTGCCTGCCCTGGAGCTTCTAGGGCCACCTCTAGCATCTGGAGACCGAATATCCCCATGCT

CAGAAGTAAAGTGACAATCAGAACCAGGTACAAGCCAGTAAAGCGGCAGATGACTGCCACTCAGCCCACATACGGCATTCTTCCCATCCCACAGTCTTAG

AGCCAGATGAGGCTAACAAGACCACAGTAGCCCCCTTCCCAGGTACCACACTGTCCCTGGAGATCCCTCCAGCCTAGCCCTGCTATAGATCTGCTCTAGA

CTGTGAAATCAGCATGTATGTGAAAAATCCCAGTCCTTGACCATGTCTCCCACTCCACCTGCAAGTGATTGCTGCCATCTGTCCTGGGTGGGATGCACCG

AGCTAGTCACGGGTGTCGGATCAGATCTTTTAAAAACACTTGTCTCATGTAATTGAGACCCGCCACCATCGCAGATGAGTGACAAGAGAGAAGGCTGTCA

ACACTTCGGTACATGGTGATCTTAAAAACACCCACCTGCACCATCACACCAGACTGTACCACTAGGGCATCCAGAACAAGCCCCACCCTAACAGTGGGGG

CAGGGAGGGTACAGCCAGGCTCACAGCACTGAGAGTCTCAACCAGCTAAGCTAAATTGCAAGCTAGATGCCTCCTGCCCCTGCCCTCAGCTGCCCAGGCC

CCAGCATGGAGATGGCCTGCACAGCAGGCTCAGCACCTCTGAGGTGTGCATTAGCCACTTATAGCAGCAGTCTGTACTCTTTCAAGTACGCAAGCTTTGA

CTTCACTACTTGCTGTAGCCTGTCCCCACTGTCTATCCAGTGCTTACTTCAACCCTAGAGGCTGCCTTGACCCGAGGAGGCATCTCACTGGTTCCGTACT

TGTGTGTGCCCTACGCCTCACTGCTGGGGCCCTGGACCCAGACCCAGGCAGGAGGGCCGACGGGTGCCTCGGTCGCTCTGGGGGCAGTTTAGATGCTGTG

AAATTAAACCCGTTCTAAGTGTACTTGTTTGAATTAACTGTATTGTAATATTATTTGTTGAATGTAGTAATTAGGTATTTATGAATATATTGCTGTAATT

TCTGACATCCCGAAAAATAAAATCTTCCTAAATC
Translation
MFGLKPPLYYLPG - UNI299 - - UNI2407 - - UNI17018 - - UNI30070 - GMSHEPKSPSIGMLSTATRTTATVNPLTPSPLNGALV

PTGSPATSSTLSAQAAPSSSFAAALRKLAKQAEEPRG - UNI299 - - UNI23735 - GSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPG

GHSVPSTPPVVTIAPTKTVNGVWRSESRQ - UNI8285 - DSGSRGSSSGRERLLVEPPLAQEKAAGPAIPSHLLSTPYPFGLSPGSVVQDSRFQPLN

 NLQRPVHHVVPPSTVTEDYLRSFRPYHTAEDLRMSSLPPLGLDPATAAAYYHPSYLAPHPFPHPAFR RMDDSYCLSALRSPFYPIPTPGSLPPLHPSA

MHLHLSGVRYPPELSHSSLAALHSERMSSLSAER RLQMDEELRREREREREREREADREREKEREREQREKEREKELEREREKERERELERQREQRARE

KELLAAKALEPTTFLPVAELHGLRGHSTEERPKPSEQLTPTRAE - UNI6451 - EKLKDVGLQAPKPVQHPLHPVPAPHHTVPSLISSHGIFSLPGS

SATTALLIQRTNEEEKWLARQRRLRQEKEDRQSQVSEFRQQVLEQHLDLGRPLVPTEAEHRPESTR - UNI27810 - RPGTNRHEQGSREPPQHFGG

PPPLISPKPQQHTVPTALWNPVSLMDNALETRRAESHSLHSHPTAFEPSRQAAVPLVKVERVYCSEKAEEPRKREATPLDKYQPPPPPPPPREAGSLEPQ

TFPHGPGPFLTELEKSTQTILGQQRPSLSQATSFGELSGPLKPGSPYCHPTARGPDPAYIYDEFLQQRRKLVSKLDLEERRRREAQEKG - UNI1304 

- GYYYDLDDSYDESDEEEVRAHLRCVAEQPPLKLDTSSE KLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPAVQCKRQTPSPRLALSTRYS

PDEMNNSPNFEEKRKFLTFFNLTHISAEKRKE EPATQPAPLETDQPVGVPASLSDVPKTTETGRLEQLRPQELLRVQEPAPPSGEKARLSEAPGGKKSL

SMLHYLRGAAPKDIPVPLSHSINGKSKPWEPFVAEEFAHQFHESVLQSTQKALQKHKG - UNI5279 - GNSALLSAEQSHKVDTAIHYNIPELQSSS

RVPLPQHNGQQEPPMGRKGPPMQEADQDSEEDSEEDSEEEAEEAPRRQWQGIEAIFEAYQEHIEE EQNLERQVLQTQCRRLEAQNYSLSLTAEQLSHSM

A ELRSQKQKMVSERERLQAELDHLRKCLALPTMHWPRGYFKGYPR
Transcript ENSMUST00000034279
Sequence
TGCCCGGGCGCTGGACGGAAAGGCAGCCTTTGATCATCTCGGAGAAGGAAAAGGAAAAAACACAAACTGGTTTCTACCCACGGTGCTCCGGGGATCGCTC

TTCTGCTTTTATTTTATTGTTTTGGACATTTTTGAGCGCCGTGGCTTGGACGCTGGTTTTGTTTCATTGCTGGGCTTGATTTTTTTTTTTTTTTCCCCTC

ATTTCCTTCTTCGTCCCTCTCTGGCCACTATGGAATTCTAACCTGAGCCATGTTCGGACTGAAGCCGCCTCTCTATTACTTACCAG - UNI299 - - 

UNI2407 - - UNI17018 - - UNI30070 - GCATGAGCCATGAGCCCAAGTCCCCTTCCATAGGGATGCTTTCCACGGCGACCAGGACCACCGC

CACCGTCAACCCCCTCACCCCCTCGCCACTCAATGGCGCCCTGGTGCCCACCGGTAGCCCGGCCACCAGCAGTACGCTGTCGGCCCAGGCCGCTCCATCC

TCCAGCTTTGCTGCCGCACTGCGCAAGCTCGCCAAACAGGCAGAGGAGCCCAGAG - UNI299 - - UNI23735 - GGTCCTCACTGAGCAGCGAG

TCATCTCCAGTGTCCTCTCCAGCCACCAACCATAGCTCTCCAGCTAGCACGCCCAAACGAGTGCCCATGGGCCCCATCATCGTCCCCCCCGGGGGTCACA

GTGTCCCCAGCACTCCCCCAGTGGTCACTATTGCCCCCACTAAAACCGTCAATGGAGTCTGGAGAAGCGAGAGCCGCCAG - UNI8285 - GACTCTG

GCTCACGAGGCAGCAGCAGTGGTCGGGAGCGCCTATTGGTGGAGCCACCTCTCGCCCAGGAAAAGGCTGCGGGCCCCGCCATCCCCTCCCACCTACTCAG

CACCCCGTACCCCTTTGGCCTTTCCCCCGGCTCAGTTGTACAGGACTCCCGCTTCCAACCACTCAA CCTCCAGCGGCCTGTGCACCATGTGGTGCCCCC

CAGCACGGTGACTGAGGACTACTTGAGAAGCTTCCGGCCCTACCACACTGCTGAAGACTTACGCATGTCCTCCTTGCCTCCGCTTGGCCTGGACCCAGCC

ACCGCCGCAGCCTACTATCACCCCAGCTACCTGGCCCCACACCCATTCCCCCACCCGGCCTTCAG GATGGATGACTCCTATTGCCTGTCAGCCTTAAGG

TCTCCGTTCTACCCCATCCCCACCCCTGGCTCCCTGCCTCCACTGCATCCGTCGGCGATGCACCTGCATCTCTCCGGCGTACGGTATCCTCCTGAGCTCT

CCCACTCGTCCCTGGCGGCGCTACACTCGGAGCGGATGTCCAGCCTCAGTGCAGAGAG GTTGCAAATGGACGAGGAACTGCGGCGGGAGAGAGAGCGAG

AGCGGGAACGGGAACGGGAGGCCGACCGGGAGCGGGAGAAGGAGCGGGAGCGGGAGCAGCGGGAGAAGGAGCGGGAGAAGGAGCTGGAGCGCGAGCGGGA

GAAGGAACGGGAGCGCGAGCTGGAGCGGCAGCGGGAGCAGCGGGCGAGGGAGAAGGAGCTGCTGGCTGCCAAGGCCTTAGAGCCCACCACCTTCCTGCCT

GTGGCCGAGCTGCACGGACTCCGAGGTCACAGCACGGAGGAGCGGCCCAAGCCCTCGGAGCAGCTGACCCCAACCCGAGCAG - UNI6451 - AGAAG

CTGAAGGACGTGGGCTTGCAGGCGCCCAAGCCCGTGCAGCACCCTCTGCACCCAGTGCCTGCCCCACACCACACGGTGCCCAGCCTCATCTCCAGCCACG

GCATCTTCTCTCTGCCTGGAAGCAGCGCCACCACCGCCCTGCTGATCCAGCGCACCAACGAGGAGGAGAAGTGGCTGGCACGGCAGCGCCGCCTGCGGCA

GGAGAAGGAAGACCGCCAGTCCCAGGTGTCCGAGTTCCGGCAGCAGGTCCTGGAGCAGCACCTAGACCTGGGCCGGCCCCTGGTGCCCACAGAGGCGGAG

CACAGGCCCGAGAGCACCAG - UNI27810 - GCCAGGAACAAACCGGCATGAGCAGGGCAGCCGTGAACCCCCACAGCACTTTGGTGGCCCTCCACC

CCTCATCTCACCCAAGCCCCAGCAGCACACCGTACCCACAGCCCTCTGGAACCCAGTGTCTCTGATGGACAATGCTCTGGAGACGCGGCGGGCCGAGAGC

CACTCTCTGCATAGCCACCCGACTGCTTTTGAGCCCAGCCGCCAGGCCGCCGTGCCACTGGTGAAGGTGGAGCGAGTTTATTGCTCAGAGAAGGCAGAGG

AGCCCCGGAAGCGTGAGGCCACACCACTGGACAAATACCAGCCACCACCACCACCACCACCACCGCGGGAGGCAGGAAGTCTGGAGCCTCAGACCTTTCC

CCACGGACCTGGGCCTTTCCTTACTGAACTTGAAAAGTCAACACAGACCATCTTGGGCCAGCAGCGGCCCTCTCTTTCCCAGGCAACCTCCTTCGGGGAG

CTCAGTGGGCCTCTGAAACCAGGCTCTCCGTACTGCCACCCCACAGCGAGGGGCCCCGATCCAGCCTACATCTACGATGAGTTTCTTCAGCAGCGACGGA

AGCTGGTCAGCAAACTGGACCTGGAGGAACGCAGGCGGCGCGAGGCCCAGGAGAAAG - UNI1304 - GGTACTACTACGACCTCGATGACTCGTACG

ACGAGAGTGACGAGGAGGAGGTCAGGGCACACCTCCGCTGTGTGGCTGAGCAGCCGCCCCTCAAACTGGACACATCCTCGGAG AAGCTAGAGTTCTTGC

AACTTTTTGGCTTGACCACCCAACAGCAGAAGGAGGAACTGGTGGCGCAGAAGCGCCGGAAGCGGAGGCGGATGCTCAGAGAGAGAAGCCCGTCGCCACC

TGCCGTTCAGTGCAAGCGACAGACGCCTTCCCCCAGGCTGGCTCTGTCCACCCGCTACAGCCCCGACGAGATGAACAACAGCCCCAACTTTGAGGAGAAG

AGGAAGTTCCTGACCTTCTTCAACTTGACGCACATCAGTGCGGAGAAGAGGAAAG ACAAAGAGAGGCTTGTTGAAATGCTCCGAGCCATGAAGCAGAGA

GCACTGTCCGCAGCAGACTCAGTGACAAACTCTTCGAGGGACAGTCCTCCCGTCTCCCTGAGTG AACCAGCCACACAGCCAGCTCCTCTAGAGACGGAT

CAGCCTGTCGGGGTCCCTGCCTCCTTGTCAGATGTCCCAAAGACCACGGAGACCGGGAGACTGGAACAGCTCCGGCCCCAGGAGCTCTTGAGAGTCCAGG

AGCCGGCTCCTCCCAGTGGTGAGAAGGCCAGGCTGAGCGAGGCCCCTGGTGGCAAGAAGAGCCTGAGCATGCTCCATTACCTCCGGGGCGCCGCGCCCAA

GGACATTCCTGTGCCGTTGTCTCACAGCATCAACGGGAAGAGCAAGCCCTGGGAGCCTTTCGTGGCCGAAGAGTTTGCACATCAATTCCACGAGTCCGTG

CTGCAGTCCACACAGAAGGCTCTGCAGAAGCATAAAG - UNI5279 - GGAACTCTGCTTTGCTATCTGCAGAGCAGAGCCACAAAGTCGACACGGCA

ATCCACTACAACATTCCCGAGCTGCAGTCCTCCAGCAGGGTCCCCTTGCCCCAGCACAATGGACAACAGGAGCCTCCAATGGGGAGGAAGGGCCCTCCTA

TGCAGGAGGCGGACCAGGACTCTGAGGAGGACTCTGAGGAGGACAGCGAGGAGGAAGCTGAGGAAGCCCCGAGGCGCCAGTGGCAAGGGATTGAGGCAAT

CTTTGAAGCTTACCAGGAACACATAGAAG AGCAAAACCTGGAGCGGCAGGTGCTGCAGACGCAGTGCCGGCGGTTGGAGGCGCAGAACTACAGCCTCAG

CCTGACTGCGGAGCAGCTGTCTCACAGCATGGCG GAGCTTCGGAGTCAGAAACAGAAGATGGTCTCTGAGCGGGAGCGGCTCCAGGCGGAGCTGGACCA

CTTGCGGAAGTGCCTTGCCTTGCCCACCATGCACTGGCCTAGGGGCTACTTTAAGGGATATCCGAGGTGACGGTTTCCCTTGCACTAGGCTGAACCTATA

GTATAGAAATATTATCTATTTTATTACCTTGAATATTTAATATTTTTCACTGGGAGGTTTGAAGCTTACAAATTGAGAACGTGCCATGCATGAAACAAAG

GGTTCCAGGCTCCAGAGAGGAGATCACCTCGACGCCAATGTCACCGAGGCACCTGTCTCAGCTAGGACTCAGTTTCTCTTTCTGAGGTCGGCGTTATTTC

CTCTCTCCCCCCACGTCATCCTCCTCCGACACTGACGTCCACCGTGCATGTGGCTGAGGGAGAGAGCCAGCTGGTTGTTTCTGGTATAGCTGTGCCACGA

GAGCCCAGCTTGCTGTTGCTGCGGCCCTGGGGTTTAACCTCTTCCTGCCAGGAGCGGGACTAATGCGCCGGGAAGGCTGGGTGCGTACAAGCAAAGGGCT

CCCCATCAGTCCCGTCCGTCTGTCGCCTTCCCGCAAGCGTCATCATCGAAGCCACTGCTCCTGGGAGCACACAAGCTTCTCCCTGGAACAGCTCTTAGGA

AAAGAGGCAAACCCACACCCAAAAGTACCTTGTTTTCCTTGGGGAAGATGCGTGGAGCTGTCCACAGATAGCCTACCCACTGGATTGCTACCGCCGTGTG

TGGTGTTTTCATACAAACGTACGTTTTGAGAGAAAAGTCAAAGGTGCTTCAGCCTTGTACTGTGTATATATTAAAAAAAAAGTTTTGTATGTTTTTATTA

CTTTAATTATTGTTATAAAAAGCCTGCCATTTTTAATATGTGGTTTGGGGAATTTTGTTTGTTTTTCCTGTTTGGGGGTTTTCTTTGGTTTTTTTGTTTG

TTTGTTTCTGTTTTTCTGGATTTAAAAAAAAAGAAAACCTTGCTTTTAGTGTTTGTACTGCTGCTGGTCAGAATGTTGTTAACTGCTCAGTTCTAGGAAG

CAGGAGAGCTCGCTTGTGCAGTGTCCCACACAGCAGGGCTGAGGGGCCTAGGGCTGCCTGCTCTCCAAAGCAGATGACCCATGTGCGGCAGGGACTCGGC

AAAGCTGTGAGGAGCTGAGCTCCGGAGACAGGCACAGCTCTGGCAGAAAGCTCAACGCTAAGGGATCTCCTTCCCAGTTTCAGCACTTCAGTCAGGGCTG

ACCAACTTGAAAAGAGCCTCCGACTGTCCTCCATCGGACAGGGGAAGAGGAGGCCGAGCCCACCCTTAGCCACCAGGCTCAGTGGCTGTACAGAGCAGCT

GGCTGACATCTGTCCCTGCTCCACCCCTGCCCCTACCCGCACCCCTCTGGTTCTCAGCAAACTCAGACAAGGCAGTGCCACCAGGCCTGTCAGCAAAGCA

CCTTCCTCTGCCCACAGCCAGTCAGAGAAAACGATCCAAAGGAGGGCAGAGGCCGCACACCCTGGGCCGAGTCCTGCCCGACTTCCCAGTTAAATGCTGC

TTGTGCCCAGTGCTGCTTTCCCAAGCTCACCCCACCTCCATGACTAGAAGCTTCTGCAAATCTGCTTGGTAAATGTCTCCTGGGAAAGGCAGAACCCATA

ACTTAAAGACACGCACAGTCCCTTCCATTGTCCCACAGGAGTTCCTCTGGCTGAGTATGCCATCCAGAGCAAGCGATGCCCTCCCAGGTCAGTCTGGGGC

ACAAGCTGAGCCGCTGACTAGCAATGCCTACAGCCTTTCCCAATGCCCTTGCCTGCCCTGGAGCTTCTAGGGCCACCTCTAGCATCTGGAGACCGAATAT

CCCCATGCTCAGAAGTAAAGTGACAATCAGAACCAGGTACAAGCCAGTAAAGCGGCAGATGACTGCCACTCAGCCCACATACGGCATTCTTCCCATCCCA

CAGTCTTAGAGCCAGATGAGGCTAACAAGACCACAGTAGCCCCCTTCCCAGGTACCACACTGTCCCTGGAGATCCCTCCAGCCTAGCCCTGCTATAGATC

TGCTCTAGACTGTGAAATCAGCATGTATGTGAAAAATCCCAGTCCTTGACCATGTCTCCCACTCCACCTGCAAGTGATTGCTGCCATCTGTCCTGGGTGG

GATGCACCGAGCTAGTCACGGGTGTCGGATCAGATCTTTTAAAAACACTTGTCTCATGTAATTGAGACCCGCCACCATCGCAGATGAGTGACAAGAGAGA

AGGCTGTCAACACTTCGGTACATGGTGATCTTAAAAACACCCACCTGCACCATCACACCAGACTGTACCACTAGGGCATCCAGAACAAGCCCCACCCTAA

CAGTGGGGGCAGGGAGGGTACAGCCAGGCTCACAGCACTGAGAGTCTCAACCAGCTAAGCTAAATTGCAAGCTAGATGCCTCCTGCCCCTGCCCTCAGCT

GCCCAGGCCCCAGCATGGAGATGGCCTGCACAGCAGGCTCAGCACCTCTGAGGTGTGCATTAGCCACTTATAGCAGCAGTCTGTACTCTTTCAAGTACGC

AAGCTTTGACTTCACTACTTGCTGTAGCCTGTCCCCACTGTCTATCCAGTGCTTACTTCAACCCTAGAGGCTGCCTTGACCCGAGGAGGCATCTCACTGG

TTCCGTACTTGTGTGTGCCCTACGCCTCACTGCTGGGGCCCTGGACCCAGACCCAGGCAGGAGGGCCGACGGGTGCCTCGGTCGCTCTGGGGGCAGTTTA

GATGCTGTGAAATTAAACCCGTTCTAAGTGTACTTGTTTGAATTAACTGTATTGTAATATTATTTGTTGAATGTAGTAATTAGGTATTTATGAATATATT

GCTGTAATTTCTGACATCCCGAAAAATAAAATCTTCCTAAATC
Translation
MFGLKPPLYYLPG - UNI299 - - UNI2407 - - UNI17018 - - UNI30070 - GMSHEPKSPSIGMLSTATRTTATVNPLTPSPLNGALV

PTGSPATSSTLSAQAAPSSSFAAALRKLAKQAEEPRG - UNI299 - - UNI23735 - GSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPG

GHSVPSTPPVVTIAPTKTVNGVWRSESRQ - UNI8285 - DSGSRGSSSGRERLLVEPPLAQEKAAGPAIPSHLLSTPYPFGLSPGSVVQDSRFQPLN

 NLQRPVHHVVPPSTVTEDYLRSFRPYHTAEDLRMSSLPPLGLDPATAAAYYHPSYLAPHPFPHPAFR RMDDSYCLSALRSPFYPIPTPGSLPPLHPSA

MHLHLSGVRYPPELSHSSLAALHSERMSSLSAER RLQMDEELRREREREREREREADREREKEREREQREKEREKELEREREKERERELERQREQRARE

KELLAAKALEPTTFLPVAELHGLRGHSTEERPKPSEQLTPTRAE - UNI6451 - EKLKDVGLQAPKPVQHPLHPVPAPHHTVPSLISSHGIFSLPGS

SATTALLIQRTNEEEKWLARQRRLRQEKEDRQSQVSEFRQQVLEQHLDLGRPLVPTEAEHRPESTR - UNI27810 - RPGTNRHEQGSREPPQHFGG

PPPLISPKPQQHTVPTALWNPVSLMDNALETRRAESHSLHSHPTAFEPSRQAAVPLVKVERVYCSEKAEEPRKREATPLDKYQPPPPPPPPREAGSLEPQ

TFPHGPGPFLTELEKSTQTILGQQRPSLSQATSFGELSGPLKPGSPYCHPTARGPDPAYIYDEFLQQRRKLVSKLDLEERRRREAQEKG - UNI1304 

- GYYYDLDDSYDESDEEEVRAHLRCVAEQPPLKLDTSSE KLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPAVQCKRQTPSPRLALSTRYS

PDEMNNSPNFEEKRKFLTFFNLTHISAEKRKD DKERLVEMLRAMKQRALSAADSVTNSSRDSPPVSLSE EPATQPAPLETDQPVGVPASLSDVPKTTE

TGRLEQLRPQELLRVQEPAPPSGEKARLSEAPGGKKSLSMLHYLRGAAPKDIPVPLSHSINGKSKPWEPFVAEEFAHQFHESVLQSTQKALQKHKG - U

NI5279 - GNSALLSAEQSHKVDTAIHYNIPELQSSSRVPLPQHNGQQEPPMGRKGPPMQEADQDSEEDSEEDSEEEAEEAPRRQWQGIEAIFEAYQEH

IEE EQNLERQVLQTQCRRLEAQNYSLSLTAEQLSHSMA ELRSQKQKMVSERERLQAELDHLRKCLALPTMHWPRGYFKGYPR

For any suggestions or comments, please send an email to unitrap@crg.es