Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031826 (Usp10)
Chromosomal location
Chr 8: 122434752 - 122481457 (+)
Description
ubiquitin specific peptidase 10 Gene [Source:MGI Symbol;Acc:MGI:894652]
RefSeq_dna
NM_009462 
RefSeq_peptide
NP_033488.1 
UniGene
Mm.256910 
MGI
MGI:894652 
Uniprot/SWISSPROT
P52479 
Uniprot/SPTREMBL
Q3T9L4 Q3TNN5 Q3TZB8 Q3U5E0 Q6ZQG9 
Human Ortholog
ENSG00000103194 (USP10)
Omim not available
UniTrap UNI5233
Vector Insertion
Chr 8: 122434840 - 122454747
Public Clones XK582 (baygenomics) YTA408 (baygenomics) RST132 (baygenomics) XK358 (baygenomics)
E125C08 (ggtc) W193E04 (ggtc) E068E08 (ggtc) M064E02 (ggtc) M098A04 (ggtc)
5SE285H04 (ggtc) IST10832H11 (tigm) IST14754B9 (tigm) IST14415A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21817
Vector Insertion
Chr 8: 122454766 - 122455748
Public Clones (ggtc)
Private Clones OST316899 (lexicon) OST194620 (lexicon) OST166275 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10955
Vector Insertion
Chr 8: 122455818 - 122460430
Public Clones (sanger) P127E11 (ggtc)
Private Clones OST262213 (lexicon) OST194710 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12824
Vector Insertion
Chr 8: 122460489 - 122465012
Public Clones (sanger) P127E11 (ggtc) CMHD-GT_373A5-3 (cmhd) IST14924B5 (tigm)
Private Clones OST237046 (lexicon) OST55890 (lexicon) OST50969 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9663
Vector Insertion
Chr 8: 122465009 - 122466039
Public Clones XG552 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI203
Vector Insertion
Chr 8: 122471711 - 122472317
Public Clones GC0233 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35346
Vector Insertion
Chr 8: 122472683 - 122474258
Public Clones IST13172G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34246
Vector Insertion
Chr 8: 122474359 - 122475820
Public Clones IST10084B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11963
Vector Insertion
Chr 8: 122475999 - 122477079
Public Clones P006B09 (ggtc) P006A09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2376
Vector Insertion
Chr 8: 122477246 - 122478688
Public Clones AD0531 (sanger) AD0244 (sanger) AD0243 (sanger) AD0532 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108982
Sequence
CTTTTGCATAATAAAAGA - UNI21817 - TATATCTTTGGCGATTTCAGCCCTGATGAATTCAATCAGTTTTTTGTGACTCCCCGCTCTTCTGTTGA

G - UNI10955 - CTCCCTCCATACAGTGGGACTCTGTGTAGCATACAGGCTGAAGATGAACTGCCAGATG - UNI9663 - - UNI12824 - G

ACAGGAGCACCAGAGGATCGAGTTTGGTGTAGATGAAGTCATCGAACCTAGTGAGGGGCTGCCGCCAACTCCTAGCTACAGTATTTCAAGCACCTTGAAC

CCCCAGGCACCCGAATTTATCCTTGGTTGTACGACTTCTAAAAAGATCCCTGAAGCCGTTGAAAAAGATGAGACCTACAGCTCCATTGACCAGTACCCCG

CCTCGGCCTTGGCTCTGGAAAGCAACTCTAACGCAGAGGCTGAGACCCTGGAGAACGACAGTGGTGCCGGCGGCCTTGGTCAGAGGGAACGGAAAAAGAA

GAAGAAGCGGCCCCCTGGGTACTACAGTTATTTGAAAGATGGCGGTGAGGACAGTGCTTCCCCAGCCACCCTGGTCAACGGCCATGCCACCTCAGTGGGC

ACGAGCGGCGAGGCTGTGGAGGACGCCGAGTTCATGGACGTGCTTCCTCCAGTCATGCCCAGGACTTGTGACAGCCCTCAGAATCCTGTGGACTTCATCA

GTGGCCCTGTCCCTGACAGTCCGTTCCCCAGGACACTAGGAGGCGATGCCAGGACTGCAGGGCTGTGTGAGGGCTGCCATGAAGCTGACTTTGAGCAGCC

CTGCCTCCCTGCAGACAGCCTGCTAAGGACAGCTGGGACGCAGCCCTACGTTGGCACCGATACTACTGAGAACTTCGCAGTTGCTAATGGGAAAATACTT

GAATCCCCGGGCGAGGACACTGCTGCCAACGGGGCAGAACTGCACACCGACGAGGGTGCAGACCTGGACCCTGCGAAGCCGGAGAGCCAGTCACCTCCTG

CCGAAAGTGCGCTCTCTGCCTCTGGCGCCATCCCCATTAGCCAGCCTGCAAAGTCCTGGGCTAGTCTCTTTCATGATTCTAAGCCCTCTGCCTCCTCACC

CATGGCGTATGTGGAAACTAAGTGTTCCCCCCCTGTCCCATCCCCCCTGGCCTCTGAAAAACAGATGGAAGTCAAAGAAGGGCTTGTTCCAGTGTCAGAG

GATCCTGTAGCCATAAAGATTGCAG - UNI9663 - AGTTATTGGAGACTGTAACCCTAATACATAAGCCAGTGTCATTGCAACCCCGTGGGCTGATC

AATAAAGGAAACTGGTGCTACATTAATGCC ACCCTGCAGGCATTGGTGGCTTGCCCTCCGATGTATCACCTGATGAAGTTCATTCCTCTGTACTCAAAA

GTGCAGCGGCCTTGCACATCAACGCCCATGATAGATAGCTT - UNI203 - TGTTCGGCTCATGAATGAGTTCACTAACATGCCAGTGCCTCCCAAAC

CCCGCCAAG CTCTCGGGGATAAAATCGTGAGAGATATCCGCCCAGGGGCTGCCTTTGAACCCACATACATATACAGACTCCTGACAGTCATCAAGTCGA

GCCTGTCTGAAAAG - UNI35346 - GGCCGGCAGGAGGACGCAGAGGAGTATCTAGGTTTCATCCTCAATGGACTCCATGAAGAGATGCTGAGCCTG

AAGAAGCTACTCTCACCCACGCACGAAA - UNI34246 - AACACTCTGTTTCCAATGGGCCCAGAAGCGACTTGATAGAGGACGAGGAGCTGGAAGA

CACGGGCAAGGGCAGCGAGGACGAGTGGGAGCAAGTGGGTCCCAAGAATAAGACGTCCATCACCCGGCAGGCGGACTTCGTCCAGACGCCCATCACTGGC

ATTTTTGGGGGACACATCAG - UNI11963 - GTCTGTGGTCTACCAGCAGAGTTCCAAAGAGTCAGCTACTCTGCAACTGTTTTTCACGCTGCAGTT

GGACATCCAGTCTGACAAGATACGCACAGTCCAGGATGCGCTGGAGAGCTTGGTGGCCAGGGAGTCTGTCCAAGGTTACACCACCAAAACCAAGCAGGAG

 - UNI2376 - GTTGAGGTGAGCCGCAGAGTGACTCTGGAGAAGCTGCCCCCTGTCCTCGTGCTCCACCTGAAGCGCTTTGTCTATGAGAAGACAGGT

GGATGCCAGAAGCTGGTCAAGAACATTGACTACCCTGTGGACTTGGAGATCAGCAGAG AACTACTTTCTCCAGGCATCAAAAATAAAAATTTTAAATGC

CAGAGAACCTATAGGCTGTTTGCAG TGGTCTACCACCATGGCAACAGCGCTACAGGCGGCCACTACACTACGGACGTCTTCCAGATTGGGCTTAATGGC

TGGCTACGAATCGATGACCAAACGGTCAAGGTTATTAACCAGTACCAGGTGGTGAAACCGCCTGCCGACCGCACAGCCTACCTCCTATATTACCGCCGCG

TGGACCTGCTGTAACCGTGCCCGTGTGCCCGTGTGTGCCTGACGCTGCTTCCTACAGTTCCCAACTCACTCACTACCCACCTCTCTAGTGGCTCTGTAGA

GAGACTCCCTCTGCGCCCGTGGGCTTGGATGGAAGGTGCCTGAGGGCCCGCACAGCGCAGCTCGTGCTGACTGACTTCAGAAGCTGGACTGTTGCCTGGG

TGAGGGCACACGAGAGCCGCCGCTTCTGAAGAACCGCTGGTTCCCGGGCGGAGGAGGCGGCTCGCACCGTGTCCCAGTCTGATCGCGTAGTGGAATAAGT

CCCGCACCAGCAGCTCTTGTAAATTTGTGAAAATGAATTTTATCTTTCCTTAAAAAAATAATTTTTTTAATTCATCACACTCTCCTCCTTTACCCTGTAG

TTTTTGATAAATGACAAAAACGAGCCAGTCGTCATTAGAGATCGCTCTTACTTCAAAAGGAAATAAATACAAAAAAAACTTGTTGCTGGTTCCTAATAGG

AAACACATTTTAACGATTACGAGAGGGAAACCGCTGACGTAGACACCGCGGGTCAGACATGTGGGTAGACGTCAGGCTGCAGAGGTGGGTGATTGTAACT

TTATTACCCTGAAAAGATTTCAAATCACATTCATGCTGTGTACACATGAACAGTGGGCACAATGATGGACTGACAATTCCCAGTGTCTGCTGTGTAATCT

CCCGCCACGCCTCTCTGATGCCGTGTCCCCCACGTACACAGTGTATTGATTCCTAGGAGTATAAAGTTGTCACCCATCAATAAAGATCACAAAGTTGGTT

T
Translation
LLHNKR - UNI21817 - YIFGDFSPDEFNQFFVTPRSSVE - UNI10955 - LPPYSGTLCSIQAEDELPDG - UNI9663 - - UNI12824

 - GQEHQRIEFGVDEVIEPSEGLPPTPSYSISSTLNPQAPEFILGCTTSKKIPEAVEKDETYSSIDQYPASALALESNSNAEAETLENDSGAGGLGQRE

RKKKKKRPPGYYSYLKDGGEDSASPATLVNGHATSVGTSGEAVEDAEFMDVLPPVMPRTCDSPQNPVDFISGPVPDSPFPRTLGGDARTAGLCEGCHEAD

FEQPCLPADSLLRTAGTQPYVGTDTTENFAVANGKILESPGEDTAANGAELHTDEGADLDPAKPESQSPPAESALSASGAIPISQPAKSWASLFHDSKPS

ASSPMAYVETKCSPPVPSPLASEKQMEVKEGLVPVSEDPVAIKIAE - UNI9663 - ELLETVTLIHKPVSLQPRGLINKGNWCYINA TLQALVACP

PMYHLMKFIPLYSKVQRPCTSTPMIDSF - UNI203 - FVRLMNEFTNMPVPPKPRQA ALGDKIVRDIRPGAAFEPTYIYRLLTVIKSSLSEK - U

NI35346 - GRQEDAEEYLGFILNGLHEEMLSLKKLLSPTHEK - UNI34246 - KHSVSNGPRSDLIEDEELEDTGKGSEDEWEQVGPKNKTSITR

QADFVQTPITGIFGGHIR - UNI11963 - RSVVYQQSSKESATLQLFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQE - UNI2376 -

 VEVSRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLVKNIDYPVDLEISRE ELLSPGIKNKNFKCQRTYRLFAV VVYHHGNSATGGHYTTDVFQIGLNG

WLRIDDQTVKVINQYQVVKPPADRTAYLLYYRRVDLL
Transcript ENSMUST00000108988
Sequence
ATGGCGGCGACGGGAGACGCGGCGTGAGAAGCCGGAGCAGCACCGAACCTCATTGAGACGGGCCGCCATGGCCCTCCACAACCCACAG - UNI5233 -

 - UNI21817 - TATATCTTTGGCGATTTCAGCCCTGATGAATTCAATCAGTTTTTTGTGACTCCCCGCTCTTCTGTTGAG - UNI10955 - CTC

CCTCCATACAGTGGGACTCTGTGTAGCATACAGGCTGAAGATGAACTGCCAGATG - UNI9663 - - UNI12824 - CAGGACAGGAGCACCAGAG

GATCGAGTTTGGTGTAGATGAAGTCATCGAACCTAGTGAGGGGCTGCCGCCAACTCCTAGCTACAGTATTTCAAGCACCTTGAACCCCCAGGCACCCGAA

TTTATCCTTGGTTGTACGACTTCTAAAAAGATCCCTGAAGCCGTTGAAAAAGATGAGACCTACAGCTCCATTGACCAGTACCCCGCCTCGGCCTTGGCTC

TGGAAAGCAACTCTAACGCAGAGGCTGAGACCCTGGAGAACGACAGTGGTGCCGGCGGCCTTGGTCAGAGGGAACGGAAAAAGAAGAAGAAGCGGCCCCC

TGGGTACTACAGTTATTTGAAAGATGGCGGTGAGGACAGTGCTTCCCCAGCCACCCTGGTCAACGGCCATGCCACCTCAGTGGGCACGAGCGGCGAGGCT

GTGGAGGACGCCGAGTTCATGGACGTGCTTCCTCCAGTCATGCCCAGGACTTGTGACAGCCCTCAGAATCCTGTGGACTTCATCAGTGGCCCTGTCCCTG

ACAGTCCGTTCCCCAGGACACTAGGAGGCGATGCCAGGACTGCAGGGCTGTGTGAGGGCTGCCATGAAGCTGACTTTGAGCAGCCCTGCCTCCCTGCAGA

CAGCCTGCTAAGGACAGCTGGGACGCAGCCCTACGTTGGCACCGATACTACTGAGAACTTCGCAGTTGCTAATGGGAAAATACTTGAATCCCCGGGCGAG

GACACTGCTGCCAACGGGGCAGAACTGCACACCGACGAGGGTGCAGACCTGGACCCTGCGAAGCCGGAGAGCCAGTCACCTCCTGCCGAAAGTGCGCTCT

CTGCCTCTGGCGCCATCCCCATTAGCCAGCCTGCAAAGTCCTGGGCTAGTCTCTTTCATGATTCTAAGCCCTCTGCCTCCTCACCCATGGCGTATGTGGA

AACTAAGTGTTCCCCCCCTGTCCCATCCCCCCTGGCCTCTGAAAAACAGATGGAAGTCAAAGAAGGGCTTGTTCCAGTGTCAGAGGATCCTGTAGCCATA

AAGATTGCAG - UNI9663 - AGTTATTGGAGACTGTAACCCTAATACATAAGCCAGTGTCATTGCAACCCCGTGGGCTGATCAATAAAGGAAACTGG

TGCTACATTAATGCC ACCCTGCAGGCATTGGTGGCTTGCCCTCCGATGTATCACCTGATGAAGTTCATTCCTCTGTACTCAAAAGTGCAGCGGCCTTGC

ACATCAACGCCCATGATAGATAGCTT - UNI203 - TGTTCGGCTCATGAATGAGTTCACTAACATGCCAGTGCCTCCCAAACCCCGCCAAG CTCTC

GGGGATAAAATCGTGAGAGATATCCGCCCAGGGGCTGCCTTTGAACCCACATACATATACAGACTCCTGACAGTCATCAAGTCGAGCCTGTCTGAAAAG 

- UNI35346 - GGCCGGCAGGAGGACGCAGAGGAGTATCTAGGTTTCATCCTCAATGGACTCCATGAAGAGATGCTGAGCCTGAAGAAGCTACTCTCA

CCCACGCACGAAA - UNI34246 - AACACTCTGTTTCCAATGGGCCCAGAAGCGACTTGATAGAGGACGAGGAGCTGGAAGACACGGGCAAGGGCAG

CGAGGACGAGTGGGAGCAAGTGGGTCCCAAGAATAAGACGTCCATCACCCGGCAGGCGGACTTCGTCCAGACGCCCATCACTGGCATTTTTGGGGGACAC

ATCAG - UNI11963 - GTCTGTGGTCTACCAGCAGAGTTCCAAAGAGTCAGCTACTCTGCAACTGTTTTTCACGCTGCAGTTGGACATCCAGTCTGA

CAAGATACGCACAGTCCAGGATGCGCTGGAGAGCTTGGTGGCCAGGGAGTCTGTCCAAGGTTACACCACCAAAACCAAGCAGGAG - UNI2376 - GT

TGAGGTGAGCCGCAGAGTGACTCTGGAGAAGCTGCCCCCTGTCCTCGTGCTCCACCTGAAGCGCTTTGTCTATGAGAAGACAGGTGGATGCCAGAAGCTG

GTCAAGAACATTGACTACCCTGTGGACTTGGAGATCAGCAGAG AACTACTTTCTCCAGGCATCAAAAATAAAAATTTTAAATGCCAGAGAACCTATAGG

CTGTTTGCAG TGGTCTACCACCATGGCAACAGCGCTACAGGCGGCCACTACACTACGGACGTCTTCCAGATTGGGCTTAATGGCTGGCTACGAATCGAT

GACCAAACGGTCAAGGTTATTAACCAGTACCAGGTGGTGAAACCGCCTGCCGACCGCACAGCCTACCTCCTATATTACCGCCGCGTGGACCTGCTGTAAC

CGTGCCCGTGTGCCCGTGTGTGCCTGACGCTGCTTCCTACAGTTCCCAACTCACTCACTACCCACCTCTCTAGTGGCTCTGTAGAGAGACTCCCTCTGCG

CCCGTGGGCTTGGATGGAAGGTGCCTGAGGGCCCGCACAGCGCAGCTCGTGCTGACTGACTTCAGAAGCTGGACTGTTGCCTGGGTGAGGGCACACGAGA

GCCGCCGCTTCTGAAGAACCGCTGGTTCCCGGGCGGAGGAGGCGGCTCGCACCGTGTCCCAGTCTGATCGCGTAGTGGAATAAGTCCCGCACCAGCAGCT

CTTGTAAATTTGTGAAAATGAATTTTATCTTTCCTTAAAAAAATAATTTTTTTAATTCATCACACTCTCCTCCTTTACCCTGTAGTTTTTGATAAATGAC

AAAAACGAGCCAGTCGTCATTAGAGATCGCTCTTACTTCAAAAGGAAATAAATACAAAAAAAACTTGTTGCTGGTTCCTAATAGGAAACACATTTTAACG

ATTACGAGAGGGAAACCGCTGACGTAGACACCGCGGGTCAGACATGTGGGTAGACGTCAGGCTGCAGAGGTGGGTGATTGTAACTTTATTACCCTGAAAA

GATTTCAAATCACATTCATGCTGTGTACACATGAACAGTGGGCACAATGATGGACTGACAATTCCCAGTGTCTGCTGTGTAATCTCCCGCCACGCCTCTC

TGATGCCGTGTCCCCCACGTACACAGTGTATTGATTCCTAGGAGTATAAAGTTGTCACCCATCAATAAAGATCACAAAGTTGGTTT
Translation
MALHNPQ - UNI5233 - - UNI21817 - YIFGDFSPDEFNQFFVTPRSSVE - UNI10955 - LPPYSGTLCSIQAEDELPDA - UNI9663

 - - UNI12824 - AGQEHQRIEFGVDEVIEPSEGLPPTPSYSISSTLNPQAPEFILGCTTSKKIPEAVEKDETYSSIDQYPASALALESNSNAEAET

LENDSGAGGLGQRERKKKKKRPPGYYSYLKDGGEDSASPATLVNGHATSVGTSGEAVEDAEFMDVLPPVMPRTCDSPQNPVDFISGPVPDSPFPRTLGGD

ARTAGLCEGCHEADFEQPCLPADSLLRTAGTQPYVGTDTTENFAVANGKILESPGEDTAANGAELHTDEGADLDPAKPESQSPPAESALSASGAIPISQP

AKSWASLFHDSKPSASSPMAYVETKCSPPVPSPLASEKQMEVKEGLVPVSEDPVAIKIAE - UNI9663 - ELLETVTLIHKPVSLQPRGLINKGNWC

YINA TLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSF - UNI203 - FVRLMNEFTNMPVPPKPRQA ALGDKIVRDIRPGAAFEPTYIYRLL

TVIKSSLSEK - UNI35346 - GRQEDAEEYLGFILNGLHEEMLSLKKLLSPTHEK - UNI34246 - KHSVSNGPRSDLIEDEELEDTGKGSEDE

WEQVGPKNKTSITRQADFVQTPITGIFGGHIR - UNI11963 - RSVVYQQSSKESATLQLFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTK

QE - UNI2376 - VEVSRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLVKNIDYPVDLEISRE ELLSPGIKNKNFKCQRTYRLFAV VVYHHGNSATG

GHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPPADRTAYLLYYRRVDLL

For any suggestions or comments, please send an email to unitrap@crg.es