Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031831 (Lrrc50)
Chromosomal location
Chr 8: 122099135 - 122122354 (+)
Description
leucine rich repeat containing 50 Gene [Source:MGI (curated);Acc:Lrrc50-001]
Human Ortholog
not available
Omim not available
UniTrap UNI34980
Vector Insertion
Chr 8: 122106914 - 122112077
Public Clones PST24803-NR (escells) IST14977H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36056
Vector Insertion
Chr 8: 122114637 - 122115600
Public Clones IST12102E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093100
Sequence
GGCCCGCCCTCGGCGGCGTAACTGACTGCGCGTGCGCACTGGTTGCCGCGGCGACCGGGAAAGCGTTGGACAGCCAACGACGCGGACCGTAGAGTATTAG

GGCTGAGTGGTCGGGCCAGGAGTGAGCATGCACCCCGAAGTCTCTGAGCCGCCGGTGGACAGCGTGGCGGAGCCCAGTCTGGAGGAGTCGGCAGGCGATC

ACGGCGACGCGGGGCCAGGGATCCGTAAAGAAG AAATTAGTGAGACCAAGGAAACATGTGCGGGTCCTTGCACAACATCCTGCCCAAGTCAGCAGCAAC

CAAGTGGCGACAACGGGTCAGAGGGCTTCTGCACCCACTCGAGAGATGACAGAGAGGATCGGGGCCCCAG GATGACGAAACAGTTCCTTCAAAAGCTCT

GCAAGCAGCACAAGCTGTACGTCACCCCCGCCCTGAACGACACCCTGTATTTGCACTTTAAGG GCTTTGACCGCATTGAGAACCTGGAGGAGTACACGG

GCCTGCGCTGCCTCTGGCTGGAGTGCAATGGCATCCAGAGGATCGAGAATCTGCAGGCCCAGAGCGAACTGCGCTGCCTCTTCCTGCAAGTGAACCTGTT

GCACAAGATCGAGAACCTGGAGCCCCTCCAGAAGCTGGACGCCCTCAACCTGAGCAACAACTACATCAAGACCATTGAGAACCTCT CCTGCCTCCCTGT

CCTGAACACACTGCAAATGGCCCACAACCGCCTGGAGACGGTGGCTGACATTGAGCACCTCAGGGAGTGTCTGCGACTCTGTGTCCTCGACCTCTCCCAC

AATGCGCTGAGTGACCCTGAGATCCTGAGCGTGCTAGAGAGCATGCCCTGTCTG - UNI34980 - CGTGTGCTGAACCTCATGGGAAACCCAGTGAC

CAAACACATCCCTAACTACCGCAGGACGGTCACTGTCCGTCTGAAGCACTTGACTTATCTGGATGACAGGCCAGTTTTCCCCAAGGACAG GGCGTGTGC

AGAGGCATGGGCCCGAGGTGGGTATGCCGCCGAGAAGGAAGAGCGTCGCCAGTGGGAGAGCAGGGAACACAAGAAGATAACAGACAGCCTGGAAGCCTTG

GCCATGATCAAGCGTCGGGCTGAGGAGCGGAAGAAGGCAAGAGATAGAG - UNI36056 - GGGAGACACCCCTGCCAGACAGCGAAGGGAGTATCCC

CACCAGCCCGGAGGCTGAGGAAAAGCAACCCATGGGGGAAATCCAGAAGAAGATGGAGTTGTTTGTGGAGGAGAGCTTTGAAGCCAAAGATGAACTGTTT

CCAGAGACGCCAGGAGGAGAAAAGGAGCTGCATGTGGTTGTGGTGAATGGGGCAGTGGAGAATCCAGACCTGTCTGGGAGCCTGGCTCACAACCAGACAC

CTGTGGTGGTCACCCCGGAAG AGTCTACATCTCCAGTGGCAGCTACTGATGGGGCCAGAACTGAAGATATAGAGGCCGTTGCCGTGGAGATCAAGGAGA

GGCTTTTCATTGAT GACCTTCCTGACTTGGAAGATGCTGAGGGTACAGATGTGTCTGTGGAAGACCAGATAAAG GAGACAGACATCCCGAGAATCCAG

GCCATTTCCAGCTTGAGTGACGACAGTGACCCGGAGCTGGACGAGCTGTCCCTCTCCACGTCTGAGGCCACTCCCACAGGCGCCACAGGTGCCCTCTCAC

ACATATTTGCCATCTCCAAGGGCCCCTCCACGGCAGCCACGGTGCCTTTCACAGACATATGTAAGCCAATAGCAACAACGGACTTAGAAAGCCAAGGTCA

AGACTGCGGTGCAGCGGCCTCACGCCCCCTCATCCAGGAGCTCAATGATGAGCCGGCAGAGGAAGCAGCAAACCAGCCACTGCCGCCCCAAACCTGTGCG

AGTGACCCTGCACTTGCCCACCCTAGTGAAGATGGAGACAGCGACAGCCAGCTGCCTGCAGCCACTCTGCTAG GAGATGGAGCGGAGGATGAAGCAGAG

TCTTCGGTGCACCCGAAGGAGCCCAGCACCCGGGTAGGCCTAGAAGATATTGAATTTGGCTTGGACTGAACCCCAAGGCAGTCTACATTGTTGGGCTAGC

GGTGGCGCAGCAGATGCAGGGCACCCTCTCCCGTGCATCACTGTGCTCTTGAGCCTGCAAGGCAGGTGCGTGAAGCTACACCAATGTGCCTTGTACCCAA

CACGTCGGTATCCCCTGGTTACAGACCCCACAAGAACATAAACACTTTAAGACGCACACAGTCAGCACGTTATTGGGCTGCCAGTCAGGCTCTCTTCTGA

TGAGGTCAGAAACCCCACCCCACCACACTGTACTGTGTATGTCCCCAAGGTAGAATGAGTGGGCTTTACACACCAGACACATCTGCTCTGCCCACATAAC

CATCTGCTCATGGCCAGTGGACAGGTTTATTCAGTCCCAGAGTCAAAGCGTCAATGCCTACTGAACCAATGTACACTGTGGCACAATCAACCTCCAACAG

CTGACCCACACTGGGCTACCTCGGGGAGCACATGAGCTGGGGCATCTTTGAGGACAGGAGGCTAAGGCTACTTTCTAGCAACCCTGCTGCACTGAGGTGC

AGGGGGTGGCTCTACCCTGGAGACGTAGCCAGATCCCCAAGCTACAGGAGCTGGCCCTTGGTCGTGGCTGCTCGGAGCTTCTGTGGCATGGTCTCCTGGC

TCTTTCTGCAGCTCCATGTGGCCCAGAGAATGGCAGTGGGAGAAGGCAGGAGACTGGGGGGACTTGGGACTGCAGGGACTCAGCATTAGCCATCCTGATG

CAGCCTCTGCAGCCAGCTCTCGGGAATATCCTACCATCAAATACACGAAGTGGACTGG
Translation
MHPEVSEPPVDSVAEPSLEESAGDHGDAGPGIRKEE EISETKETCAGPCTTSCPSQQQPSGDNGSEGFCTHSRDDREDRGPR RMTKQFLQKLCKQHKL

YVTPALNDTLYLHFKG GFDRIENLEEYTGLRCLWLECNGIQRIENLQAQSELRCLFLQVNLLHKIENLEPLQKLDALNLSNNYIKTIENLS SCLPVLN

TLQMAHNRLETVADIEHLRECLRLCVLDLSHNALSDPEILSVLESMPCL - UNI34980 - RVLNLMGNPVTKHIPNYRRTVTVRLKHLTYLDDRPVF

PKDR RACAEAWARGGYAAEKEERRQWESREHKKITDSLEALAMIKRRAEERKKARDRG - UNI36056 - GETPLPDSEGSIPTSPEAEEKQPMGEI

QKKMELFVEESFEAKDELFPETPGGEKELHVVVVNGAVENPDLSGSLAHNQTPVVVTPEE ESTSPVAATDGARTEDIEAVAVEIKERLFID DLPDLED

AEGTDVSVEDQIK ETDIPRIQAISSLSDDSDPELDELSLSTSEATPTGATGALSHIFAISKGPSTAATVPFTDICKPIATTDLESQGQDCGAAASRPLI

QELNDEPAEEAANQPLPPQTCASDPALAHPSEDGDSDSQLPAATLLG GDGAEDEAESSVHPKEPSTRVGLEDIEFGLD

For any suggestions or comments, please send an email to unitrap@crg.es