Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031832 (Taf1c)
Chromosomal location
Chr 8: 122121874 - 122129129 (-)
Description
TATA box binding protein (Tbp)-associated factor, RNA polymerase I, C Gene [Source:MGI (curated);Acc:Taf1c-001]
RefSeq_dna
NM_021441 
RefSeq_peptide
NP_067416.2 
UniGene
Mm.41977 
MGI
MGI:109576 
Uniprot/SWISSPROT
Q6PDZ2 
Uniprot/SPTREMBL
Q3U0N4 
Human Ortholog
ENSG00000103168 (TAF1C)
Omim not available
UniTrap UNI32442
Vector Insertion
Chr 8: 122128139 - 122129130
Public Clones IST14631D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3441
Vector Insertion
Chr 8: 122127366 - 122128139
Public Clones AS0135 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093099
Sequence
CGGCCTGATCCGGAAAACAGTTTAGTCTGCTCCAACAGTTGTGGGTGGCGGCGTTGAGGTTCGGCACTCTGGCTCCTTTGCGGCCCCGGGGTCAG - UN

I32442 - GATGGACTTCCCTGGCACCCTGCGCCCTTCATTGTTTAAGGCCGGTCCACTTGGCATGACTGATGGCCCTGACCTGTCCTTCATGTGCAGC

TGGAGAGATGCACTGACCCTGCCAGGGTCCCAGCCACAGAACTGCAAG - UNI3441 - - UNI32442 - GATCCGACCTTGTCCTTTGCCAAGAA

CCTACTGTGGGAGCCATCGACGCCAGGACCCCTCCCCCTCCTGATGCCTCCTGATCCTG ATCCCTGGGACCCTGGTGTGACAGCTCAGGACTTCCTTTT

CCGGGGAGGTCACTGCTACCAGTACCAGTCTCAGGCTGTGCTGGATGTCACTGAGCAG CTCAGCCGCTTCCTGTGGGACCATGGGGACATAGCCTTCGC

ACCCCTGGGGAGACTCATGCTGGAGAACTTCAGATTGGAGGGGAACCGG GGCTACTCGAAAAAGATGACTATAGTCAGCGCGAAGAAGCTGCTTCAGGA

CCTCGGCGGACACCAACCCTGGGG GTGTCCCTGGGCTTCCCTCAGCCGCCGGCTGCGTCGCTTCTCCATCGTTGGGGGTCCTGTCCTGAGCAGGTCAGT

GTCACTACTCATGGGGAAGCTACTGCATGAAGAGCTGGCCATGCGCTGGGAGCAGCTGCTGATGGATGAGGCCTTCACCGGGGGCGCGTTGGCCTGGCTG

CCCGGAAGGACAGCGCGGGCCGGACAGCTGGTCTACCCTAGTGGAGGTGCCTTGGACAAGCTGT ATTTCCAGGAGGTCAGTGTGACTTCAGGTGGCAAC

CCCCGGATCCTTGAGAACCCTGGGCACGTCCAGCTGCGGGGACCTGTACGGCAGGTGGTGACCAGCACCGTCCAGGGAGAAA CGCTTCTGGCCGTCCGC

TCTGACTATCACTGTGCCACGTGGAAGATTGATAAGCAGGGGCCACCAGCACTCCTGCAGGTGATGCAGGTGGAGAAAGGGGCCACTGGTATTAGCCTCA

G CCCTCACCTGTCAGGAGAGCTGGCCATCTGCAGCCGTTCCGGAGCTGTTTGTCTGTGGACCCCACAAGCTGG GCTGCAGACGATCTACAAGGACACC

GAGACGCTTGCCTTCCGTGATCCGTCTCCCTGGCGCTGGGCAGACTTCACTGCCCACCCCCGGGTGCTGACTGTGGGGGACCGCACGGGTGTGAAAATGG

TTGACATTCAG GGCCCACCGGGCTGTGGGCTGCTGCTGTTCCGCGCTGGAGCAGAGGCTGCCTGCCAGAAAGGAGAGCGGGTGCTGCTTGCCCAGTACC

TAGGGCAGCCAGGTCAGACCCCTCCATCTCTGCATCTCATCTGCACCCAG TTCTCGATCTACCTGATGGATGAGCGCCTCCCCCTGGTGCCCATGCTTA

AGTGGGACCATGGCTTGCCATCTGCTCCCCTGCTTGCCCGCCTGCTACCCCCAGCTAGCCCTGGCCATCCACGGCCCCTGCTACTGGGGGGCCAGGGTGG

GCAGCTGCAGCTGCTTCATATAACAG GAGAGGGAACTTCCATGCCACAGCTGGCGGGGCCTCCTCAGTCTCTGCCCTCCATCACCGAATCCCTCTCTGC

CTTTCCCCTGCTGGAACCTAAGAAGCAGCAGCTGCTGCAGGAACGTCTGGAGGCACCAGTCATAG GTCTGGCTGCTGTCCCCCTCTGTGCCTCTGCCCC

GGGGCTGTTGCTCTTCCAGCTCTCAGCAGCCGGGGATGTCTTCTACCAGCACCTACGGCTCCTGCAAGCCTCCAGTCCTAGAAAGGTGCCAGAGCAAGCA

ACAGCACCCTCAGTGGACCAGGTGTCCACGCCCTCTTGGACCCCTCAGGCCAGTGCCCGTTGCAGCCGCTGGTTGGAGGACCTGATGGAGTTGTCCCCCA

CTCGTCCATTGTGGGTCGCCCCGACCTTCTCCCATCGCCGTTTTCTGGGCCACATGGAGCGGCAGAAGAGCCAAGAGACCATGCCACAGAAGCTCCGAGC

AGCCATGGCCAAGGGCCAGCTCCTGCGGCCTGGGGACCTGAGTACACTCCCCAGGGCAGAGCCACCCCCTGCACCTCAGTGCAGCCAACAGGATGAGCTC

ACTGAGCGCTTGACAGAAGCCTGGGAAGGCCGGGTGACTGCCTGGTGGAGGAGACATCGAGGTGAGACCTCCGAGACCCAGACCCAGTCCAAGCGGCCTA

AGCGGCGGACTCAGTTGTCTAGCACCTTCTCCTCATTCACAAGCTACCTGGACTCCCCAGATGCCAGCAGTGCCCCTCGTAGCCAAGACCTCTCTACCTC

AGAGGCCCGTCTTCAGTCACCCAGGGTTCCACCCTCCCAGGAGTTGACACAGGAGGTGTGGGGCCAAGGTGTGAAGCGTGAACGCCGGCAGACCCTCCGG

GATCACACGGACAAGCTGCCACTTAAGAGGGACACTCCAGGACCTGTGGCTACACCACCCTCCCAGGCCTCTAGCCTCCAGACCATGTCTTTCAGGCAGC

AGACGCCTGTCCACTCTGGCTCCCAGCCTCCCCAGAAGAAGCCACGAATGGGCTTCTGAGTGGGGAAAGCCATATCTGAGAACCTAGCCTTCATCCTGGA

GTGCTGCACTGAGCTCAGCCACTCCAGGGCAGAGCCTCCTCTGCCTCTGCCATGCAGAGAGCAGTGTGCCCATGGAAACGTGAGCAGTGTAGAACTAGGC

TGAAGCAATGGGGAACCAGTCCACTTCGTGTATTTGATGGTAGGATATTCCCGAGAGCTGGCTGCAGAGGCTGCATCAGGATGGCTAATGCTGAGTCCCT

GCAGTCCCAAGTCCCCCCAGTCTCCTGCCTTCTCCCACTGCCATTCTCTGGGCCACATGGAGCTGCAGAAAGAGCCAGGAGACCATGCCACAGAAGCTCC

GAGCAGCCACGACCAAGGGCCAGCTCCTGTAGCTTGGGGATCTGGCTACGTCTCCAGGGTAGAGCCACCCCCTGCACCTCAGTGCAGCAGGGTTGCTAGA

AAGTAGCCTTAGCCTCCTGTCCTCAAAGATGCCCCAGCTCATGTGCTCCCCGAGGTAGCCCAGTGTGGGTCAGCTGTTGGAGGTTGATTGTGCCACAGTG

TACATTGGTTCAGTAGGCATTGACGCTTTGACTCTGGGACTGAATAAACCTGTCCACTGGCCATGAGCAGATGGTTATGTGGGCAGAGCAGATGTG
Translation
 - UNI32442 - MDFPGTLRPSLFKAGPLGMTDGPDLSFMCSWRDALTLPGSQPQNCK - UNI3441 - - UNI32442 - DPTLSFAKNLLWEP

STPGPLPLLMPPDPD DPWDPGVTAQDFLFRGGHCYQYQSQAVLDVTEQ LSRFLWDHGDIAFAPLGRLMLENFRLEGNR GYSKKMTIVSAKKLLQDLG

GHQPWG GCPWASLSRRLRRFSIVGGPVLSRSVSLLMGKLLHEELAMRWEQLLMDEAFTGGALAWLPGRTARAGQLVYPSGGALDKLY YFQEVSVTSGG

NPRILENPGHVQLRGPVRQVVTSTVQGET TLLAVRSDYHCATWKIDKQGPPALLQVMQVEKGATGISLS SPHLSGELAICSRSGAVCLWTPQAG GLQ

TIYKDTETLAFRDPSPWRWADFTAHPRVLTVGDRTGVKMVDIQ GPPGCGLLLFRAGAEAACQKGERVLLAQYLGQPGQTPPSLHLICTQ FSIYLMDER

LPLVPMLKWDHGLPSAPLLARLLPPASPGHPRPLLLGGQGGQLQLLHITG GEGTSMPQLAGPPQSLPSITESLSAFPLLEPKKQQLLQERLEAPVIG G

LAAVPLCASAPGLLLFQLSAAGDVFYQHLRLLQASSPRKVPEQATAPSVDQVSTPSWTPQASARCSRWLEDLMELSPTRPLWVAPTFSHRRFLGHMERQK

SQETMPQKLRAAMAKGQLLRPGDLSTLPRAEPPPAPQCSQQDELTERLTEAWEGRVTAWWRRHRGETSETQTQSKRPKRRTQLSSTFSSFTSYLDSPDAS

SAPRSQDLSTSEARLQSPRVPPSQELTQEVWGQGVKRERRQTLRDHTDKLPLKRDTPGPVATPPSQASSLQTMSFRQQTPVHSGSQPPQKKPRMGF

For any suggestions or comments, please send an email to unitrap@crg.es