Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031861 (Lpar2)
Chromosomal location
Chr 8: 72346328 - 72355000 (+)
Description
lysophosphatidic acid receptor 2 Gene [Source:MGI Symbol;Acc:MGI:1858422]
Human Ortholog
not available
Omim not available
UniTrap UNI38549
Vector Insertion
Chr 8: 72346611 - 72347461
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066018
Sequence
ATGGGCCAGTGCTACTACAACGAGACCATCGGCTTTTTCTATAATAACAGCGGCAAGGAGCTCAGCCTTCACTGGCGCCCCAAAGATGTGGTGGTGGTGG

CCCTGGGGCTGACAGTCAGTGTGCTGGTATTGCTGACCAATCTGCTGGTTATTGCAGCCATCGCCTCCAACCGACGCTTCCACCAGCCCATATACTACCT

GCTTGGCAACTTGGCTGCGGCTGACCTCTTCGCTGGCATGGCCTACCTCTTCCTCATGTTCCATACTGGCCCA CACTGCCAGGCTCTCCATCAAAGGCT

GGTTCCTGCGACAGGGCCTGCTGGACACCAGCCTCACGGCGTCAGTGGCCACACTGCTGGC ATCGCTGTGGAACGGCACCGCAGTGTGATGGCGGTACA

GCTACACAGCCGCCTGCCCCGGGGCCGTGTGGTCACACTCATCGTGGGTGTGTGGGCGGCTGCACTGGGTCTGGGGTTGCTACCTGCACACTTCTGGCAC

TGCCTCTGTGACTTGGACAGTTGCTCACGCATGGTGCCCCTGTTCAGCCGCTCCTACTTGGCTGCGTGGGCCCTATCCAGCCTGCTTGTCTTCCTACTCA

TGGTAGCTGTCTACACACGAATTTTCTTCTATGTGCGTAGACGGGTGGAACGCATGGCGGAGCACGTCAGCTGCCATCCCCGCTACCGAGAGACCACACT

CAGCCTAGTCAAGACGGTTGTCATCATTCTGG GGGCATTTGTGGTGTGCTGGACACCGGGCCAGGTGGTGCTGCTCCTGGATGGCCTGGACTGTAAGTC

CTGCAACGTTCTGGCTGTGGAGAAGTACTTCCTGCTCCTGGCTGAGGCCAACTCACTGGTCAATGCAGTGGTATATTCCTGCCGAGATGCTGAGATGCGC

CGCACCTTCCGCCGCCTTCTCTGCTGCATGTGTCTCCGCTGGTCCAGCCACAAGTCTGCCCGTTACTCAGCTTCTGCCCAGACGGGTGCCAGCACGCGGA

TCATGCTTCCTGAGAATGGCCGCCCACTGATGGACTCCACCCTTTAA
Translation
MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIYYLLGNLAAADLFAGMAYLFLMFHTGP HCQALHQR

LVPATGPAGHQPHGVSGHTAG IAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPAHFWHCLCDLDSCSRMVPLFSRSYLAAWALSSLLVFL

LMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTVVIILG GAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAEANSLVNAVVYSCRDA

EMRRTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENGRPLMDSTL
Transcript ENSMUST00000034325
Sequence
GGGAAAAGGGGGCTGTGGGGAGGCGGTGAAATGACCACAGTTTCAGGAGATCACACTTCCGACGTGGGGGTGGGACTTTCCAGGGGGCGGGACACCCCCA

AGGGCCAAGAGCTAAGGCAGGTGGGGGCGTGGCTTTGAGGTCCCGCCTCTCCCGCCTCCTCAGCCGGGGGCTCCAGGAACACCGGACGCTGCTGCGCAAC

CGCTCGGTTGCCCGGCCATGGGTCTCAGTCCTGCTTCAACCCACCGCGAGCCAGCCCCATCTGCCGCTTGACTGGATGTGCAG - UNI38549 - GCA

GCCATCATGGGCCAGTGCTACTACAACGAGACCATCGGCTTTTTCTATAATAACAGCGGCAAGGAGCTCAGCCTTCACTGGCGCCCCAAAGATGTGGTGG

TGGTGGCCCTGGGGCTGACAGTCAGTGTGCTGGTATTGCTGACCAATCTGCTGGTTATTGCAGCCATCGCCTCCAACCGACGCTTCCACCAGCCCATATA

CTACCTGCTTGGCAACTTGGCTGCGGCTGACCTCTTCGCTGGCATGGCCTACCTCTTCCTCATGTTCCATACTGGCCCACGCACTGCCAGGCTCTCCATC

AAAGGCTGGTTCCTGCGACAGGGCCTGCTGGACACCAGCCTCACGGCGTCAGTGGCCACACTGCTGGCCATCGCTGTGGAACGGCACCGCAGTGTGATGG

CGGTACAGCTACACAGCCGCCTGCCCCGGGGCCGTGTGGTCACACTCATCGTGGGTGTGTGGGCGGCTGCACTGGGTCTGGGGTTGCTACCTGCACACTT

CTGGCACTGCCTCTGTGACTTGGACAGTTGCTCACGCATGGTGCCCCTGTTCAGCCGCTCCTACTTGGCTGCGTGGGCCCTATCCAGCCTGCTTGTCTTC

CTACTCATGGTAGCTGTCTACACACGAATTTTCTTCTATGTGCGTAGACGGGTGGAACGCATGGCGGAGCACGTCAGCTGCCATCCCCGCTACCGAGAGA

CCACACTCAGCCTAGTCAAGACGGTTGTCATCATTCTGG GGGCATTTGTGGTGTGCTGGACACCGGGCCAGGTGGTGCTGCTCCTGGATGGCCTGGACT

GTAAGTCCTGCAACGTTCTGGCTGTGGAGAAGTACTTCCTGCTCCTGGCTGAGGCCAACTCACTGGTCAATGCAGTGGTATATTCCTGCCGAGATGCTGA

GATGCGCCGCACCTTCCGCCGCCTTCTCTGCTGCATGTGTCTCCGCTGGTCCAGCCACAAGTCTGCCCGTTACTCAGCTTCTGCCCAGACGGGTGCCAGC

ACGCGGATCATGCTTCCTGAGAATGGCCGCCCACTGATGGACTCCACCCTTTAAACCTTGGACTGAGGCAGGAGACTGGAGCTTCATCTGCAGCCTATGG

TCACTTGCAGAGCCTCTGACTCAAGCCAGCCCAGCAGATGCATGGCTCTTCAACACTCCCTGCCCCAGGGACAGAGAGAGTCTGCCTGCCCCTGGACAGA

GGGACTTGGGGACATCTCCGTCCATGCACCTGGGGAGAGCATCCTAATGGGACTTGGCCGTCTGGTTCTCAATCATCTCAGGTTTTAGGGTTTTTAACAG

ACATTTTCATATTTTTACTGTGTTATCTCTGGATGTCTGTGGACTGCTGCTTCCTACATGGTGCTGTAGCTATTGGGACAGAAGAGGTGAGAGCTGTCCC

AGGCTATACCACCTACTGTTACAGGGTAGACTGTAGGAGTACTGTCTTCCTGAGGCGGCTTTTGGTTGTTTTGTTTTGCTTTTGAGATAGGCTCTCATGT

AGCCTAGGCGGCCTTGAATTCACTGTGTAGGTGAGGATGGCCTTGAACTCTTGATGGTCCTGACTCCCAAGTGCTAGTACTGAAGCTGATTCCTTAGATG

TGCTGAGCAGCCTGAGGGCTCACCTGCCTCCCTTAGTACGAGGGACCCCATGACACAGAGCAAGCCTTTCCACTCTGAGGTTGCAGAGTTGGGGTTTGGT

TTGGTTTAGTTAGGATTTTTTTCTGTTGGTTGGCAGGTGTTTTGCCATTACTTCAGTCAGTCTGTCCCAGTGTCCTGGAATCATGACTCAGGGCTGCCAA

GAATCCTTCAACATGAAATCCCATGGCCCCAGCCAGCCTTGAACTTGCTGCATAGACTAGGCTGTTCTTGAATCCATTGTCTTGCCTCCGAATTGTAGAT

GTTGGGATTAGAGCTATATGCTGCCATACCCAGTTTTTGTCTCTTCCTGGAGTCTTACAAATGTTTCTTTCCTTTTGCCTCTGTCCTACCCAGCTCTCTC

TTTAAAGAACCTAGGATGATTTCTAGTTTGTGCAAACCTTCTCCTTCTGCCTGCCTCACCCCCTTTTTTTTTAGACCCAAAGTCTCACAGTGCAGCCCAG

TCCACCCTAGAGCTCACTGTGCCACTCAGGCTAATATCAAACTCTCAGGTCTCTTCCTGCCTGGGCTCCCTGAGTGCTAGGAATGACAAGCCATATTGAG

CCTGTGTCTGACTGCACAGCTTGGAAAAGCACAGCTATGCAGGGGGCACCAGAAAACTCCATGAGGAAGGGCTTCAGTGTCCCTTGGACTTTCTACTTCT

GAGTCCCCCAAGACCTCAGATATGCCAGGCCTGAGGTTAACTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCGCCAG

AGAAGCCTCCTAGCAGGCAGTGTGAGCCATGAACTTGGCTCCCTGCTCTGCCTCACCAGAGAGGAGTCGGGGTTATGTTCTCACCTCAGATTCACAGCCG

AGGAACAGCAGGAACTTGAACCTCTGTCTTATCTGAGGCCAAATTCTTAAGGCATTAAAGCATCTGTTTCTTAAGAACGGAAAACGTCTCTTTCTTTCTA

CAGTCAGTGCCCGGCTTTTCCCACAGCTAGGACCTTGCACACTCTAGGCAAGTTCCCCAGCACAGATCTTCTATCACGTGAGCCATGTCCAAAAGGAAAA

CAGTGCAGACCGAACTGAAGGGCTGGATTGCAGTGGGCCTTTGCTTCTTTGTGGGTTCTTTTTTCTCACTCTTTATGCCTCTGGTTTCACCCCATCAGTC

ACAAGATAGAAAAAGAAAAAGGGAGAAAGATACTGAGATCTGTGAATCTAATTTCTTTCTTCCTGTTTCTTCTTTGAGCACAACTACTAACAAACTATGA

TCAACCAACCACACTACCTATGGGGCCCTAGCATTCATACACCCTTGAAAAAGTTTCCAGAATTCTAAACATCACACAACCACAGAAACTCTCTGCAGTT

GGCAAAACTGTGCCTCATGTTCCAAGGTGATAGCCCAGGAACCTCTGCAGCCAGGTGTTCATTAAGGACAGTGTCCCTGAAGCCAGGTGTCCATGAAGGA

CAGTGTCCCTGCAGCCAGGTGTCCATGAAGGACAGTGTCCCTGCAGCCAGGTGTCCATGAAGGACAGTGTCCCTTTCCTACCTCCTAGGAGCTCCAGGCA

TACTGGACATGGGTCACTTTAGGGATGGGTGGAGGCAGCCAATTGAATCCTGATTTGGGGACCTCTGATGGCCTGCAGAAGTCAGCTCTGTCACCTGTCC

TTAGTGGCTGTCCTCCATCAGCACCATCCAGATGCTATCCAGGGATTTATCTTGTCAACCTTTACATTTTATTTTCCCTTTTCCACTTAGAGGCATTATG

CTTTTTTGTTCTTTGAGACAGGGACTCACTGTGTAGCACTGGCTGGCCTCTAACTCACAAAGATCAGCCTGCCTCTGCCTCCTGAGAGCTGGGATTAAAG

GAAAGTGCCTTGTGATTTACAGATTTCTGCACTTGCGTGGATGCACCTCTGCATGTGGAGGCTGGAGATGTGTCAAGTCAGCCCTGAAGGCAGGGCCACC

TTAGTCAACATAGCAGGGTCTCTGTCACATCCAGAGCTCACCAATACAGCTAGTCTCACTGGGCATCTTGTTCTGAGCAATCCCCTGTCTCTGCCCTCCA

AGGCAGGAGATATACTCAGGACACTGCTCCTGTCCCCACTTTTATGTGGATTTCTGAGGTTCTGAATTCTGGTCTTCAAACTTGAGTAGCAAGCGCTTTA

AAAAGTACTGAGCCATTGCCCTAGCCTGGCTTTTCCTTGACTTCTCTGCTGTGTGACATCAAGCTTTTGTCTCTTTTAGACCATTGGAACTTACAGTCTT

CTCCCTCCCCCAGATCAGGCCTGTGCAGTGCTGGGCCACTGTCTGACCTTTTGTACACTCTGGGCCCACCTTAAAGGCTTCTATTACTTCCTGTGGCTGG

GGCCAAGCCTAGGGTTTTCCTTGTGCTTACACATTTGAATTTCTTGCCAGGCACCCCCGGAAGTCTCCATCTTCCCCATGCCCCGTCGCCCCCATACACA

CATGCTGCTTGAGTTTCCTCTTCAGTAAGAACAAAAGGCAGATGACTTGACTTCGCAGTCACACTGACCCTTCACCAAGCCTTCACCTGAATTCTGTCTC

TGAGCAAACATTCAGGGAGGCTCTGTATCTCTAGAGAGGGATTTGTGTGTGTGTGTGTGTGTGTGTGTCCCTTTTTAGGACTCACAAACAAGAGAGACAA

AAGGCCTGTGAGAGTTCTCTGTCTTGGGGTACACCTGAGCATTGATATTCGGCAAAGTCTTCATTCTTTAGCCATGTGCTAGCATTTGCTAGACCTGGAA

TGCTGGGGTTGGAAGGAAGGACTGGATCTAAGGAACTCAGCAGGGAGAAGCGCTTCCTGCCAAGCCTGGCAACAAGAGTTCAATCCCTGGACTCATGGTA

GTAGAGACCCAAGTCCTGAAAGTTGTTCTCTGACCTCCACACTTGGGCTATGATGTACAAACACATCACACTTGTGCTGTGGTGTGTAAACACATTGTGT

GTGTGCATGCACGCACACACATACACACAATGACAAAATTTTAAAAGAACAAACAGGTTGAGGTCACTCCCACGTTGGATCTTGATAAAACAATAGAGTT

AACTTCTCCAGTGGAGAAAGGTACTGGATTCTAGCTTCCTTCCTGCCATCTACACAAATCTACACTTTTCATCTGTCCCCCCACCCCCCCCAAGCCTGGT

AAAAGGGAAACAGAAAGGTTTAGGGAAAGGCACGGTGGAGGGATAACCTTTTTGTGCACTGTATAAAGCATGTCTTCCTATTACCCAGATGCTGGTTTTG

TTAACACCCCTCTCTCCCCTTCTGACTGGTTTTAATAAAAAGCTGTTGGCCTATAGTGAAGCCGGAGACTGCCAGCTCCGGACTTGCAGGGAGAGATTGA

ACTCTGAAGGAGTCAGGCTCTAGAAGCCCAACATGGAGGAAGAAGCAGGCTCCAGTACTAGAGACCGAGAGGTCACAAGCCATGAGGCAGACATGGAATA

ATATAAATGTGTTAGTAGAAGTTGTACGAGCTAGTTGGGAACAAGCCTAGCTATAAGGCCTAGGCATTTATAAATAAACATGTCTCTGTATCTTTATTCA

GAGTTGGGGTAAGCATGGAAGGTCCATACGGTTATAACAGGATTCTGGTGACCAGCCAAAGGAGACTATGCTCGAGGGGCCCAGGACTTATGGGAAACAG

TCATACCCCTCCAGGCTGGATATGGTCATTGCCATGTTGAATCAAGAACTGCGTTCATTCATGCATGACCTCACAAGTTTGGACCACTAATATGTTTTTG

TACAAATACAGGACATATGCATAGGACCACTCTCCTCAATAAAGATTATAGACCCATAATGAAGGTGGGGGAGGGAAGATGATACATTTCTGCTGGAGCT

GCCCATGCATTGGGGAGGAACCTCAATAAAGTCCCTGGTTCACAAAACTGG
Translation
 - UNI38549 - MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIYYLLGNLAAADLFAGMAYLFLM

FHTGPRTARLSIKGWFLRQGLLDTSLTASVATLLAIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPAHFWHCLCDLDSCSRMVPLFSRSY

LAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTVVIILG GAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAEAN

SLVNAVVYSCRDAEMRRTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENGRPLMDSTL

For any suggestions or comments, please send an email to unitrap@crg.es