Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031862 (Atp13a1)
Chromosomal location
Chr 8: 72315149 - 72331637 (+)
Description
ATPase type 13A1 Gene [Source:MGI Symbol;Acc:MGI:2180801]
RefSeq_dna
NM_133224 
RefSeq_peptide
NP_573487.1 
MGI
MGI:2180801 
Uniprot/SWISSPROT
Q9EPE9 
Uniprot/SPTREMBL
Q69Z96 B2RS54 
Human Ortholog
ENSG00000105726 (ATP13A1)
Omim not available
UniTrap UNI3163
Vector Insertion
Chr 8: 72322832 - 72323219
Public Clones XT0382 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093467
Sequence
GAAAGATGGCGGTGGTGGGCAACGCGGTTCCTTGCGGAGCCCGGCCTGGCGGGGCCCGGGACAACGGGTCTCCTCAGCCTGGGTCGCGATTGCGGCCGGG

CCTAGCTGCCGGGCCAGCACTCATAGCGAACGGCGACGAACTGGTGGCCGCCGTGTGGCCGTACCGGCGGCTGGCGCTTCTGCGGCGCCTCACCGTGCTG

CCGTTTGCCGGGCTGCTGTACCCAGCCTGGCTGGGCGCCGCCGCCAGCGGTTGCTGGGGATGGGGCAGCAGCTGGACCCAGATACCCGAGGCCGCGCTGC

TGGCGCTCGCCACCATCTGCCTCGCGCACGCACTCACTGTCCTGTCGGGGCATTGGTCTGTGCACGCGCACTGCGCGCTCACCTGCACCCCG GAGTATG

ATCCCAACAAAGTAACCTTTGTGAAGGTGGTGCCAACCCCCAACAATGGCTCCACTGAGCTTGTGGCCCTGCACCGTGACAAG GGTGAAGATGGGCTGG

AGGTGCTGTCATTTGAATTCCAGAAGATCAAATATTCCTATGATGCCCTGGAGAAAAAGCAGTTCCTTCCGGTGGCCTTCCCAGTGGGGAATGCCTTCTC

TTACTATCAAAGCAACAGAGGCTTCCAGGAAGACTCAGAGATCCGAGCTGCAGAGAAGAAGTTTGGAAGCAACAA GGCTGAGATGGTAGTGCCCGACTT

CTCTGAGCTTTTCAAGGAGAGAGCCACAGCCCCTTTCTTCGTGTTTCAG GTATTCTGCGTTGGGCTCTGGTGCCTGGACGAGTATTGGTACTACAGTGT

CTTCACTCTGTCCATGCTGGTGGCTTTCGAAGCTTCCCTAGTGCAGCAGCAGATGAGGAACATGTCAGAGATCCGAAAGATGGGCAACAAGCCCCATATG

ATACAG GTCTACCGCAGCCGAAAGTGGAGGCCTGTCGCCAGTGATGACATTGTTCCTGGGGACATCGTGTCTATCGGTGAGGCA CAGGGCAGACTACT

GCGTACAATTCTCTTTGGGGTAAAGAGGGTCACTGCAAACAACTTGGAGACCTTTATCTTCATCCTCTTCCTCCTGGTCTTCGCCATTGCTGCAGCTGCG

TATGTGTGGGTTGAAG GGACCAAGGACCCCAGCCGGAACCGTTACAAGCTCTTTCTGGAGTGCACCCTCATCCTCACCTCTGTTGTACCCCCTGAACTG

CCCATTGAACTGTCTCTGGCTGTCAACACCTCCCTCATCGCCTTGGCCAAGCTCT ACATGTACTGCACAGAGCCTTTCCGGATCCCCTTCGCTGGCAAG

GTTGAAGTGTGTTGCTTTGACAAGACGGGTACCTTGACCAGTGACAGCCTGGTGGTGCGAGGCGTGGCAGGGCTGAG - UNI3163 - AGATGGGAAA

GAGGTGACCCCAGTGTCCAGCATTCCCATAGAAACACACCGGGCCCTGGCCTCCTGCCACTCGCTCATGCAGCTGGATGACGGCACCCTAGTGGGTGACC

CTCTGGAAAAGGCCATGCTGACAGCTGTGGACTGGACACTGACCAAAG ATGAGAAAGTATTCCCCCGAAGTATTAAAACTCAGGGGCTGAAAATTCACC

AGCGCTTTCATTTTGCCAGTGCCCTAAAGCGAATGTCTGTGCTCGCCTCCTACGAGAAGCTTGGCTCCACTGACCTCTGCTACATCGCGGCTGTGAAGGG

GGCCCCCGAAACCCTGCACTCTATG TTTTCTCAGTGCCCACCTGACTACCACCACATCCACACTGAGATCTCTCGGGAAGGAGCCCGTGTCCTGGCTCT

GGGATACAAGGAGCTAGGACATCTCACACATCAGCAG GCCCGGGAGATCAAGCGGGAGGCACTGGAGTGCAGCCTCAAGTTTGTGGGCTTCATCGTGGT

CTCCTGTCCCCTCAAAGCTGACTCCAAGGCTGTGATCCGAGAGATCCAGAATGCATCCCACAGG GTGGTCATGATCACAGGAGACAACCCCCTCACTGC

ATGCCATGTAGCTCAGGAGCTGCACTTCATTGACAAAGCCCACACGCTCATCTTGCATCCTCCCTCGGAGAAAG GCCAGCCATGTGAGTGGCGCTCCAT

TGATAGCAGCATCGTTCTGCCTCTCACCCTGGGCTCCCCCAAGGCACTGGCCCTGGAGCACGCGCTATGCCTCACAGGCGATGGCTTGGCTCACCTGCAG

GCTGTGGACCCCCAGCAGCTGCTCTGCCTCATCCCTCATGTGCAGGTGTTTGCCCGTGTAGCCCCTAAGCAGAAG GAATTTGTCATCACTAGCCTGAAG

GAGCTGGGTTATGTGACCCTTATGTGTGGAGATGGCACCAACGATGTGGGCGCACTGAAGCACGCTGATGTGG GTGTAGCACTCCTGGCCAATGCCCCT

GAGAGGGTTGTAGAACGGCGGCGACGGCCAAGGGACAGCCCTGTCCTGAGCAACAGTGGCCCCAGAGTCTCCAGGTCCACCAAACAGAAGTCGGCACTCC

TCTCTCCTGAGGAGCCACCAGCTTCCCACAGG GACCGCCTGAGCCAGGTGCTGCGGGACCTGGAGGAGGAGAGCACCCCCATCGTGAAGCTGGGGGATG

CCAGCATCGCAGCACCCTTCACCTCCAAGCTGTCCTCCATCCAGTGCA TCTGCCACGTGATCAAGCAGGGCCGGTGCACATTGGTGACGACGCTGCAGA

TGTTCAAGATCCTGGCCCTCAATGCCCTCATCCTGGCATACAGCCAAAGTGTCCTCTACCTGGAGGGTGTCAAGTTCAGTGACTTCCAGGCCACACTGCA

GGGGCTGCTGCTGGCCGGCTGCTTCCTCTTCATCTCCCGCTCCAAG CCTCTCAAGACTCTTTCCCGAGAGCGGCCCCTACCCAACATCTTCAACCTGTA

CACCATCCTTACGGTGATGCTGCAATTCTCTGTCCACTTCCTGAGCCTGGTCTACCTGTACCGTGAGGCCCAGGCACGCAGCCCTGAGAA GCAGGAGCA

GTTTGTAGACCTGTACAAGGAGTTTGAGCCGAGCCTGGTCAACAGCACTGTGTACATCATGGCCATGGCCATGCAGATGGCCACCTTCGCCATCAACTAC

AAG GGCCCACCCTTCATGGAGAGCCTGCCTGAGAACAAGCCCCTGGTGTGGAGTCTGGCAGTGTCACTGCTGGCCATCATTGGCTTGCTCCTTGGTTCC

TCACCTGACTTCAACAGCCAGTTTGGCCTTGTGGACATCCCTGTAGAG TTCAAGCTGGTCATCGGCCAGGTCCTGGCCCTGGACTTCTGCCTGGCACTC

CTGGCTGACCGTGTCCTACAGTTCTTTTTGGGGACTCCGAAGCTGAGAGTGCCTTCCTGAGAAGATGGTGCTGGTATCCACTGCCTACCCTGGCTGCCAC

TGAACAGGAAAACCGCCGCTGCCCCAGGAGGGAGCACTGCTCCCATCTCCACAGTGAGGCAGCCCTGCCTTGCTCTTGGAAGACTGAGTTGGGACCCTTG

TGGGCATCCGCTGGCCGGGCTAGTAGAAGAGTCCTGGCTAGCACCTTTGGTAAATAAATCGGCGTCTGC
Translation
MAVVGNAVPCGARPGGARDNGSPQPGSRLRPGLAAGPALIANGDELVAAVWPYRRLALLRRLTVLPFAGLLYPAWLGAAASGCWGWGSSWTQIPEAALLA

LATICLAHALTVLSGHWSVHAHCALTCTP EYDPNKVTFVKVVPTPNNGSTELVALHRDK GEDGLEVLSFEFQKIKYSYDALEKKQFLPVAFPVGNAFS

YYQSNRGFQEDSEIRAAEKKFGSNK KAEMVVPDFSELFKERATAPFFVFQ VFCVGLWCLDEYWYYSVFTLSMLVAFEASLVQQQMRNMSEIRKMGNKP

HMIQ VYRSRKWRPVASDDIVPGDIVSIGEA QGRLLRTILFGVKRVTANNLETFIFILFLLVFAIAAAAYVWVEG GTKDPSRNRYKLFLECTLILTSV

VPPELPIELSLAVNTSLIALAKLY YMYCTEPFRIPFAGKVEVCCFDKTGTLTSDSLVVRGVAGLR - UNI3163 - RDGKEVTPVSSIPIETHRALA

SCHSLMQLDDGTLVGDPLEKAMLTAVDWTLTKD DEKVFPRSIKTQGLKIHQRFHFASALKRMSVLASYEKLGSTDLCYIAAVKGAPETLHSM FSQCPP

DYHHIHTEISREGARVLALGYKELGHLTHQQ AREIKREALECSLKFVGFIVVSCPLKADSKAVIREIQNASHR VVMITGDNPLTACHVAQELHFIDKA

HTLILHPPSEKG GQPCEWRSIDSSIVLPLTLGSPKALALEHALCLTGDGLAHLQAVDPQQLLCLIPHVQVFARVAPKQK EFVITSLKELGYVTLMCGD

GTNDVGALKHADVG GVALLANAPERVVERRRRPRDSPVLSNSGPRVSRSTKQKSALLSPEEPPASHR DRLSQVLRDLEEESTPIVKLGDASIAAPFTS

KLSSIQCI ICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVLYLEGVKFSDFQATLQGLLLAGCFLFISRSK PLKTLSRERPLPNIFNLYTILTVM

LQFSVHFLSLVYLYREAQARSPEK KQEQFVDLYKEFEPSLVNSTVYIMAMAMQMATFAINYK GPPFMESLPENKPLVWSLAVSLLAIIGLLLGSSPDF

NSQFGLVDIPVE FKLVIGQVLALDFCLALLADRVLQFFLGTPKLRVPS
Transcript ENSMUST00000034326
Sequence
GAAAGATGGCGGTGGTGGGCAACGCGGTTCCTTGCGGAGCCCGGCCTGGCGGGGCCCGGGACAACGGGTCTCCTCAGCCTGGGTCGCGATTGCGGCCGGG

CCTAGCTGCCGGGCCAGCACTCATAGCGAACGGCGACGAACTGGTGGCCGCCGTGTGGCCGTACCGGCGGCTGGCGCTTCTGCGGCGCCTCACCGTGCTG

CCGTTTGCCGGGCTGCTGTACCCAGCCTGGCTGGGCGCCGCCGCCAGCGGTTGCTGGGGATGGGGCAGCAGCTGGACCCAGATACCCGAGGCCGCGCTGC

TGGCGCTCGCCACCATCTGCCTCGCGCACGCACTCACTGTCCTGTCGGGGCATTGGTCTGTGCACGCGCACTGCGCGCTCACCTGCACCCCG GAGTATG

ATCCCAACAAAGTAACCTTTGTGAAGGTGGTGCCAACCCCCAACAATGGCTCCACTGAGCTTGTGGCCCTGCACCGTGACAAG GGTGAAGATGGGCTGG

AGGTGCTGTCATTTGAATTCCAGAAGATCAAATATTCCTATGATGCCCTGGAGAAAAAGCAGTTCCTTCCGGTGGCCTTCCCAGTGGGGAATGCCTTCTC

TTACTATCAAAGCAACAGAGGCTTCCAGGAAGACTCAGAGATCCGAGCTGCAGAGAAGAAGTTTGGAAGCAACAA GGCTGAGATGGTAGTGCCCGACTT

CTCTGAGCTTTTCAAGGAGAGAGCCACAGCCCCTTTCTTCGTGTTTCAG GTATTCTGCGTTGGGCTCTGGTGCCTGGACGAGTATTGGTACTACAGTGT

CTTCACTCTGTCCATGCTGGTGGCTTTCGAAGCTTCCCTAGTGCAGCAGCAGATGAGGAACATGTCAGAGATCCGAAAGATGGGCAACAAGCCCCATATG

ATACAG GTCTACCGCAGCCGAAAGTGGAGGCCTGTCGCCAGTGATGACATTGTTCCTGGGGACATCGTGTCTATCG GCCGCTCACCCCAGGAGAACTT

GGTGCCCTGTGATGTACTGCTGCTACGGGGCCGCTGCATTGTAGACGAGGCCATGCTCACTGGGGAATCTGTGCCACAAATGAAG GAGCCCATTGAAGA

CCTGAGCCCAGACCGTGTCCTAGACCTGCAGGCCGATGCTCGGCTGCATGTCATCTTTGGGGGCACCAAGGTGGTACAGCACATTCCCCCGCAGAAGGCC

ACCTCGGGCCTGAAGC CGGTCGACAATGGATGTGTGGCCTTTGTCCTGAGAACTGGGTTCAACACATCCCAG GGCAGACTACTGCGTACAATTCTCTT

TGGGGTAAAGAGGGTCACTGCAAACAACTTGGAGACCTTTATCTTCATCCTCTTCCTCCTGGTCTTCGCCATTGCTGCAGCTGCGTATGTGTGGGTTGAA

G GGACCAAGGACCCCAGCCGGAACCGTTACAAGCTCTTTCTGGAGTGCACCCTCATCCTCACCTCTGTTGTACCCCCTGAACTGCCCATTGAACTGTCT

CTGGCTGTCAACACCTCCCTCATCGCCTTGGCCAAGCTCT ACATGTACTGCACAGAGCCTTTCCGGATCCCCTTCGCTGGCAAGGTTGAAGTGTGTTGC

TTTGACAAGACGGGTACCTTGACCAGTGACAGCCTGGTGGTGCGAGGCGTGGCAGGGCTGAG - UNI3163 - AGATGGGAAAGAGGTGACCCCAGTG

TCCAGCATTCCCATAGAAACACACCGGGCCCTGGCCTCCTGCCACTCGCTCATGCAGCTGGATGACGGCACCCTAGTGGGTGACCCTCTGGAAAAGGCCA

TGCTGACAGCTGTGGACTGGACACTGACCAAAG ATGAGAAAGTATTCCCCCGAAGTATTAAAACTCAGGGGCTGAAAATTCACCAGCGCTTTCATTTTG

CCAGTGCCCTAAAGCGAATGTCTGTGCTCGCCTCCTACGAGAAGCTTGGCTCCACTGACCTCTGCTACATCGCGGCTGTGAAGGGGGCCCCCGAAACCCT

GCACTCTATG TTTTCTCAGTGCCCACCTGACTACCACCACATCCACACTGAGATCTCTCGGGAAGGAGCCCGTGTCCTGGCTCTGGGATACAAGGAGCT

AGGACATCTCACACATCAGCAG GCCCGGGAGATCAAGCGGGAGGCACTGGAGTGCAGCCTCAAGTTTGTGGGCTTCATCGTGGTCTCCTGTCCCCTCAA

AGCTGACTCCAAGGCTGTGATCCGAGAGATCCAGAATGCATCCCACAGG GTGGTCATGATCACAGGAGACAACCCCCTCACTGCATGCCATGTAGCTCA

GGAGCTGCACTTCATTGACAAAGCCCACACGCTCATCTTGCATCCTCCCTCGGAGAAAG GCCAGCCATGTGAGTGGCGCTCCATTGATAGCAGCATCGT

TCTGCCTCTCACCCTGGGCTCCCCCAAGGCACTGGCCCTGGAGCACGCGCTATGCCTCACAGGCGATGGCTTGGCTCACCTGCAGGCTGTGGACCCCCAG

CAGCTGCTCTGCCTCATCCCTCATGTGCAGGTGTTTGCCCGTGTAGCCCCTAAGCAGAAG GAATTTGTCATCACTAGCCTGAAGGAGCTGGGTTATGTG

ACCCTTATGTGTGGAGATGGCACCAACGATGTGGGCGCACTGAAGCACGCTGATGTGG GTGTAGCACTCCTGGCCAATGCCCCTGAGAGGGTTGTAGAA

CGGCGGCGACGGCCAAGGGACAGCCCTGTCCTGAGCAACAGTGGCCCCAGAGTCTCCAGGTCCACCAAACAGAAGTCGGCACTCCTCTCTCCTGAGGAGC

CACCAGCTTCCCACAGG GACCGCCTGAGCCAGGTGCTGCGGGACCTGGAGGAGGAGAGCACCCCCATCGTGAAGCTGGGGGATGCCAGCATCGCAGCAC

CCTTCACCTCCAAGCTGTCCTCCATCCAGTGCA TCTGCCACGTGATCAAGCAGGGCCGGTGCACATTGGTGACGACGCTGCAGATGTTCAAGATCCTGG

CCCTCAATGCCCTCATCCTGGCATACAGCCAAAGTGTCCTCTACCTGGAGGGTGTCAAGTTCAGTGACTTCCAGGCCACACTGCAGGGGCTGCTGCTGGC

CGGCTGCTTCCTCTTCATCTCCCGCTCCAAG CCTCTCAAGACTCTTTCCCGAGAGCGGCCCCTACCCAACATCTTCAACCTGTACACCATCCTTACGGT

GATGCTGCAATTCTCTGTCCACTTCCTGAGCCTGGTCTACCTGTACCGTGAGGCCCAGGCACGCAGCCCTGAGAA GCAGGAGCAGTTTGTAGACCTGTA

CAAGGAGTTTGAGCCGAGCCTGGTCAACAGCACTGTGTACATCATGGCCATGGCCATGCAGATGGCCACCTTCGCCATCAACTACAAG GGCCCACCCTT

CATGGAGAGCCTGCCTGAGAACAAGCCCCTGGTGTGGAGTCTGGCAGTGTCACTGCTGGCCATCATTGGCTTGCTCCTTGGTTCCTCACCTGACTTCAAC

AGCCAGTTTGGCCTTGTGGACATCCCTGTAGAG TTCAAGCTGGTCATCGGCCAGGTCCTGGCCCTGGACTTCTGCCTGGCACTCCTGGCTGACCGTGTC

CTACAGTTCTTTTTGGGGACTCCGAAGCTGAGAGTGCCTTCCTGAGAAGATGGTGCTGGTATCCACTGCCTACCCTGGCTGCCACTGAACAGGAAAACCG

CCGCTGCCCCAGGAGGGAGCACTGCTCCCATCTCCACAGTGAGGCAGCCCTGCCTTGCTCTTGGAAGACTGAGTTGGGACCCTTGTGGGCATCCGCTGGC

CGGGCTAGTAGAAGAGTCCTGGCTAGCACCTTTGGTAAATAAATCGGCGTCTGC
Translation
MAVVGNAVPCGARPGGARDNGSPQPGSRLRPGLAAGPALIANGDELVAAVWPYRRLALLRRLTVLPFAGLLYPAWLGAAASGCWGWGSSWTQIPEAALLA

LATICLAHALTVLSGHWSVHAHCALTCTP EYDPNKVTFVKVVPTPNNGSTELVALHRDK GEDGLEVLSFEFQKIKYSYDALEKKQFLPVAFPVGNAFS

YYQSNRGFQEDSEIRAAEKKFGSNK KAEMVVPDFSELFKERATAPFFVFQ VFCVGLWCLDEYWYYSVFTLSMLVAFEASLVQQQMRNMSEIRKMGNKP

HMIQ VYRSRKWRPVASDDIVPGDIVSIG GRSPQENLVPCDVLLLRGRCIVDEAMLTGESVPQMK EPIEDLSPDRVLDLQADARLHVIFGGTKVVQHI

PPQKATSGLKP PVDNGCVAFVLRTGFNTSQ GRLLRTILFGVKRVTANNLETFIFILFLLVFAIAAAAYVWVEG GTKDPSRNRYKLFLECTLILTSVV

PPELPIELSLAVNTSLIALAKLY YMYCTEPFRIPFAGKVEVCCFDKTGTLTSDSLVVRGVAGLR - UNI3163 - RDGKEVTPVSSIPIETHRALAS

CHSLMQLDDGTLVGDPLEKAMLTAVDWTLTKD DEKVFPRSIKTQGLKIHQRFHFASALKRMSVLASYEKLGSTDLCYIAAVKGAPETLHSM FSQCPPD

YHHIHTEISREGARVLALGYKELGHLTHQQ AREIKREALECSLKFVGFIVVSCPLKADSKAVIREIQNASHR VVMITGDNPLTACHVAQELHFIDKAH

TLILHPPSEKG GQPCEWRSIDSSIVLPLTLGSPKALALEHALCLTGDGLAHLQAVDPQQLLCLIPHVQVFARVAPKQK EFVITSLKELGYVTLMCGDG

TNDVGALKHADVG GVALLANAPERVVERRRRPRDSPVLSNSGPRVSRSTKQKSALLSPEEPPASHR DRLSQVLRDLEEESTPIVKLGDASIAAPFTSK

LSSIQCI ICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVLYLEGVKFSDFQATLQGLLLAGCFLFISRSK PLKTLSRERPLPNIFNLYTILTVML

QFSVHFLSLVYLYREAQARSPEK KQEQFVDLYKEFEPSLVNSTVYIMAMAMQMATFAINYK GPPFMESLPENKPLVWSLAVSLLAIIGLLLGSSPDFN

SQFGLVDIPVE FKLVIGQVLALDFCLALLADRVLQFFLGTPKLRVPS

For any suggestions or comments, please send an email to unitrap@crg.es