Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031885 (Cbfb)
Chromosomal location
Chr 8: 107694574 - 107741886 (+)
Description
core binding factor beta Gene [Source:MGI Symbol;Acc:MGI:99851]
RefSeq_dna
NM_022309 
RefSeq_peptide
NP_071704.2 
UniGene
Mm.399600 Mm.2018 
MGI
MGI:99851 
Uniprot/SWISSPROT
Q08024 
Uniprot/SPTREMBL
Q3UYR3 
Human Ortholog
ENSG00000067955 (CBFB)
Omim not available
UniTrap UNI26780
Vector Insertion
Chr 8: 107695293 - 107702492
Public Clones IST12129E9 (tigm)
Private Clones OST97866 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33745
Vector Insertion
Chr 8: 107702610 - 107718374
Public Clones IST14580C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4967
Vector Insertion
Chr 8: 107718492 - 107726351
Public Clones AC0576 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4091
Vector Insertion
Chr 8: 107726479 - 107739803
Public Clones AN1168 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38536
Vector Insertion
Chr 8: 107726479 - 107739803
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109392
Sequence
GAGAGGAAGTGGCGGCCGCAGCCGGGGGAGGCTGGAAGCTGTGTCTGCGCGGGCGGGCGGGAGGGAGGACGGCCGGCAACGGCTGAGGCGGGCGGCGGTA

GCGTGGGTTGGGCTCCAAGCACACGGCCGCACCTCAGCCTCCCTGGAGCGGGAGGCCACGCGGGCGGGCTCCTGAAACAAAGAGAAGCGGGAGTCCGGGT

GCCGCGGGTGGGCGGTCAAGGCGGTCAGCACCGGAGCCCGCCAGCGGGTGCCCGCGCGAGCCTGGGGAGCGCGGCCGGCCGGCGCGGCCTGAGGGCGGGA

AGATGCCGCGCGTCGTCCCGGACCAGAGGAGCAAGTTCGAGAACGAGGAGTTCTTCAGGAAGCTGAGCCGCGAGTGCGAG ATTAAGTACACGGGCTTCA

GGGACCGGCCCCACGAGGAGCGCCAGACACGCTTCCAGAACGCCTGCCGCGACGGTCGCTCGGAGATC - UNI26780 - GCTTTTGTGGCTACAGGA

ACCAATCTGTCTCTCCAGTTTTTTCCGGCCAGCTGGCAGGGAGAACAGCGACAAACACCTAGCCGGGAATATGTCGACTTAGAGAGAGAAGCAGGCAAG 

- UNI33745 - GTATACTTGAAGGCTCCCATGATTCTGAATGGAGTGTGTGTTATATGGAAGGGCTGGATTGATCTCCACAGATTGGATGGTATGGGT

TGCCTGGAGTTTGATGAGGAGCGAGCCCAG - UNI4967 - CAGGAAGATGCATTAGCACAACAGGCCTTTGAAGAGGCTCGAAGAAGAACTCGAGAA

TTTGAGGATAGAGACAGGTCTCACCGGGAGGAAATGGAGGTGAGAGTTTCACAGCTGCTGGCAGTAACTG - UNI4091 - GCAAGAAGACAGCAAGA

CCCTAGTCCTGGTTCTAACTTAGGTGGCGGTGATGATCTCAAACTTCGTTAAGTGGAGCACAGCTTATGTGCCCCATCTCTACACACACTGCTTCTAGTT

GGTATAAATAACTCATTGGGCGACCAGAAACTGTGACAACTGGAGGGACTGCAGTTGGTTTCATGGCCTGAGGCAGTGAAGACGTCACCCACTGCCATGG

TTTTGCACTATAATGCCTGCATTTCTAATTTTTAAAATATGTAGCCAGTAATAATTTGAAATTTTTTTCTATGCAAGCTTATCTTGTTGGCATTATTTTA

GTTGTATCGAAAGTATATACTTTCTTCATTTTAACTTAAAAGCTCATGTCATTTAGAAACAAGATAAGAAATTAAAATTTGTATCAGGGTTGCTTAACAT

TCTTTTATACTTTCAGACGAGTTGGTTATACAGCTTTCCTCCTTAGATAAGGGTTCTTGGTTTTTGTTTGTTTTCTCTACATCATTTCGTGTTTTTGTAT

TCTGCACCATTTTACAAATGAAGATGTGTTTGCAGTTATTTTTTCCAGCTATAAACCTAGAATAGAGCTGTCTGCCACAGCCTCCTAAAACAAACGTTTA

CAGTTGTTAAAGCCACAGTATCCTTTCAAATGCTGATAGTCACCCTATCCCCTTTAGACAAAAATTCACATTAGTATTAAATTTTGTCTCAGACCCTGTT

TCAAGGTATATCTTGTAATCATGAGTTTGGGTAGAGATGCTCTTCACAGGTGAGAATGCTCTACAGAAATGCCCAAAGAAGCCACAGACTGGCTTCTGTT

TTATTCAGGGATTTTTTTTTTAATCAGTCAGAAAAAGGATACTGGAACTTGTTGTATGTAACAGCATATTAAACTGGAGGCAGTGATAAATCAGCTACAC

AGGTAAATTGTGTTAAAATAATGTTTAAGATAGCTGCTTTCATGTGTATTTTGTATTTTGTATTGCATGCTTTTGTAGAAACAAAATTGGGTGATGAAGA

TGAGTCTTAGAAAATGTTCATCTGGGCAGAAGATGCATTTCTCCCATTGATTCCGGGCAAAACATTCACAGATATAGATGATGGTATTTTACAAAAGGAC

TATTAATAGTGCCTTTTGAGATGAATCAATGTAACGATATTTTTAAAACAGGCTTAGTGTCAAATTGCAATTTTTTAAATATAAAACTGGAAAAAGTGCT

AAGTCATTGGCACATGCTTACAATACTTTCCGTGGTCGTATTCATTAAATGTTACTACATTTCTGAATTTTTGCAAAAATGTATTTTATCATAAAATGGC

ATTATTTTAGAAAATTTTAAAAACTGACATGGTCAATTCAGAAAAGTCTGAATAAGGTCATTGCATTTAAAAAGCATATAAAGATACTTGATTGTGGAAG

TGTGTCTTTCATTGTATATAGGTCTTATAATTCATAAACAAGTACCCTGTATCTCAAAATAAAAATATTTGTTATATATTTGAAGTCGTGCATGATAAGG

ATTGTGTTTGAATTATTATAAACAATAATGTGTTACAGAAGCTGATGCTGACCTTGTGTTACTGAGCACTATGAATGAATTTGCTTGGTATTTGGTGTTG

TACAGCTCACATGTTTACACTCTCAGTGCCCTGATGCCTCTCGGGAGTTACCTTTTTAAAGTGATCCTTTCTTTTTTAAAATAACATCTCGGTGGTACAT

TTTCTCTGTTGCTTCTCGCCAAGAGCTTCCAGTCCGGCAGTCAGTAAGATCACATGGTGTTAATGTGGCCGTCCCTCTGTAAATAGCAAATGTTCCTTAC

TGGTTCTGCACTGCTTCTGTCTGTCTTAATGCTGGCGTTAAGATCATAAACTCCTTTTCTTCGGTAGTGCAGGCTTTGAAAATTAAGTTATTGATGCAAT

TTCATATTTTTCATAATCTGTATTTAAAATGACATCATTGCATCATTTTTTAAAGATTCATCTCCATTAAAACTTGCCTTAAGCTTCCAGATTGCTTTGC

CGTTAGCTTTACTGTATATTTGTATGTTTTATTTACTTTCACATTAAAATTCTGTGTACTGAAAAC
Translation
MPRVVPDQRSKFENEEFFRKLSRECE IKYTGFRDRPHEERQTRFQNACRDGRSEI - UNI26780 - AFVATGTNLSLQFFPASWQGEQRQTPSREY

VDLEREAGK - UNI33745 - VYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQ - UNI4967 - QEDALAQQAFEEARRRTREFEDRDR

SHREEMEVRVSQLLAVTG - UNI4091 - GKKTARP
Transcript ENSMUST00000109394
Sequence
GAGAGGAAGTGGCGGCCGCAGCCGGGGGAGGCTGGAAGCTGTGTCTGCGCGGGCGGGCGGGAGGGAGGACGGCCGGCAACGGCTGAGGCGGGCGGCGGTA

GCGTGGGTTGGGCTCCAAGCACACGGCCGCACCTCAGCCTCCCTGGAGCGGGAGGCCACGCGGGCGGGCTCCTGAAACAAAGAGAAGCGGGAGTCCGGGT

GCCGCGGGTGGGCGGTCAAGGCGGTCAGCACCGGAGCCCGCCAGCGGGTGCCCGCGCGAGCCTGGGGAGCGCGGCCGGCCGGCGCGGCCTGAGGGCGGGA

AGATGCCGCGCGTCGTCCCGGACCAGAGGAGCAAGTTCGAGAACGAGGAGTTCTTCAGGAAGCTGAGCCGCGAGTGCGAG ATTAAGTACACGGGCTTCA

GGGACCGGCCCCACGAGGAGCGCCAGACACGCTTCCAGAACGCCTGCCGCGACGGTCGCTCGGAGATC - UNI26780 - - UNI33745 - GTATA

CTTGAAGGCTCCCATGATTCTGAATGGAGTGTGTGTTATATGGAAGGGCTGGATTGATCTCCACAGATTGGATGGTATGGGTTGCCTGGAGTTTGATGAG

GAGCGAGCCCAG - UNI4967 - CAGGAAGATGCATTAGCACAACAGGCCTTTGAAGAGGCTCGAAGAAGAACTCGAGAATTTGAGGATAGAGACAGG

TCTCACCGGGAGGAAATGGAG - UNI4091 - GCAAGAAGACAGCAAGACCCTAGTCCTGGTTCTAACTTAGGTGGCGGTGATGATCTCAAACTTCGT

TAAGTGGAGCACAGCTTATGTGCCCCATCTCTACACACACTGCTTCTAGTTGGTATAAATAACTCATTGGGCGACCAGAAACTGTGACAACTGGAGGGAC

TGCAGTTGGTTTCATGGCCTGAGGCAGTGAAGACGTCACCCACTGCCATGGTTTTGCACTATAATGCCTGCATTTCTAATTTTTAAAATATGTAGCCAGT

AATAATTTGAAATTTTTTTCTATGCAAGCTTATCTTGTTGGCATTATTTTAGTTGTATCGAAAGTATATACTTTCTTCATTTTAACTTAAAAGCTCATGT

CATTTAGAAACAAGATAAGAAATTAAAATTTGTATCAGGGTTGCTTAACATTCTTTTATACTTTCAGACGAGTTGGTTATACAGCTTTCCTCCTTAGATA

AGGGTTCTTGGTTTTTGTTTGTTTTCTCTACATCATTTCGTGTTTTTGTATTCTGCACCATTTTACAAATGAAGATGTGTTTGCAGTTATTTTTTCCAGC

TATAAACCTAGAATAGAGCTGTCTGCCACAGCCTCCTAAAACAAACGTTTACAGTTGTTAAAGCCACAGTATCCTTTCAAATGCTGATAGTCACCCTATC

CCCTTTAGACAAAAATTCACATTAGTATTAAATTTTGTCTCAGACCCTGTTTCAAGGTATATCTTGTAATCATGAGTTTGGGTAGAGATGCTCTTCACAG

GTGAGAATGCTCTACAGAAATGCCCAAAGAAGCCACAGACTGGCTTCTGTTTTATTCAGGGATTTTTTTTTTAATCAGTCAGAAAAAGGATACTGGAACT

TGTTGTATGTAACAGCATATTAAACTGGAGGCAGTGATAAATCAGCTACACAGGTAAATTGTGTTAAAATAATGTTTAAGATAGCTGCTTTCATGTGTAT

TTTGTATTTTGTATTGCATGCTTTTGTAGAAACAAAATTGGGTGATGAAGATGAGTCTTAGAAAATGTTCATCTGGGCAGAAGATGCATTTCTCCCATTG

ATTCCGGGCAAAACATTCACAGATATAGATGATGGTATTTTACAAAAGGACTATTAATAGTGCCTTTTGAGATGAATCAATGTAACGATATTTTTAAAAC

AGGCTTAGTGTCAAATTGCAATTTTTTAAATATAAAACTGGAAAAAGTGCTAAGTCATTGGCACATGCTTACAATACTTTCCGTGGTCGTATTCATTAAA

TGTTACTACATTTCTGAATTTTTGCAAAAATGTATTTTATCATAAAATGGCATTATTTTAGAAAATTTTAAAAACTGACATGGTCAATTCAGAAAAGTCT

GAATAAGGTCATTGCATTTAAAAAGCATATAAAGATACTTGATTGTGGAAGTGTGTCTTTCATTGTATATAGGTCTTATAATTCATAAACAAGTACCCTG

TATCTCAAAATAAAAATATTTGTTATATATTTGAAGTCGTGCATGATAAGGATTGTGTTTGAATTATTATAAACAATAATGTGTTACAGAAGCTGATGCT

GACCTTGTGTTACTGAGCACTATGAATGAATTTGCTTGGTATTTGGTGTTGTACAGCTCACATGTTTACACTCTCAGTGCCCTGATGCCTCTCGGGAGTT

ACCTTTTTAAAGTGATCCTTTCTTTTTTAAAATAACATCTCGGTGGTACATTTTCTCTGTTGCTTCTCGCCAAGAGCTTCCAGTCCGGCAGTCAGTAAGA

TCACATGGTGTTAATGTGGCCGTCCCTCTGTAAATAGCAAATGTTCCTTACTGGTTCTGCACTGCTTCTGTCTGTCTTAATGCTGGCGTTAAGATCATAA

ACTCCTTTTCTTCGGTAGTGCAGGCTTTGAAAATTAAGTTATTGATGCAATTTCATATTTTTCATAATCTGTATTTAAAATGACATCATTGCATCATTTT

TTAAAGATTCATCTCCATTAAAACTTGCCTTAAGCTTCCAGATTGCTTTGCCGTTAGCTTTACTGTATATTTGTATGTTTTATTTACTTTCACATTAAAA

TTCTGTGTACTGAAAAC
Translation
MPRVVPDQRSKFENEEFFRKLSRECE IKYTGFRDRPHEERQTRFQNACRDGRSEI - UNI26780 - - UNI33745 - VYLKAPMILNGVCVIWK

GWIDLHRLDGMGCLEFDEERAQ - UNI4967 - QEDALAQQAFEEARRRTREFEDRDRSHREEME - UNI4091 - ARRQQDPSPGSNLGGGDDLK

LR
Transcript ENSMUST00000109395
Sequence
GAGAGGAAGTGGCGGCCGCAGCCGGGGGAGGCTGGAAGCTGTGTCTGCGCGGGCGGGCGGGAGGGAGGACGGCCGGCAACGGCTGAGGCGGGCGGCGGTA

GCGTGGGTTGGGCTCCAAGCACACGGCCGCACCTCAGCCTCCCTGGAGCGGGAGGCCACGCGGGCGGGCTCCTGAAACAAAGAGAAGCGGGAGTCCGGGT

GCCGCGGGTGGGCGGTCAAGGCGGTCAGCACCGGAGCCCGCCAGCGGGTGCCCGCGCGAGCCTGGGGAGCGCGGCCGGCCGGCGCGGCCTGAGGGCGGGA

AGATGCCGCGCGTCGTCCCGGACCAGAGGAGCAAGTTCGAGAACGAGGAGTTCTTCAGGAAGCTGAGCCGCGAGTGCGAG ATTAAGTACACGGGCTTCA

GGGACCGGCCCCACGAGGAGCGCCAGACACGCTTCCAGAACGCCTGCCGCGACGGTCGCTCGGAGATC - UNI26780 - GCTTTTGTGGCTACAGGA

ACCAATCTGTCTCTCCAGTTTTTTCCGGCCAGCTGGCAGGGAGAACAGCGACAAACACCTAGCCGGGAATATGTCGACTTAGAGAGAGAAGCAGGCAAG 

- UNI33745 - GTATACTTGAAGGCTCCCATGATTCTGAATGGAGTGTGTGTTATATGGAAGGGCTGGATTGATCTCCACAGATTGGATGGTATGGGT

TGCCTGGAGTTTGATGAGGAGCGAGCCCAG - UNI4091 - - UNI4967 - GCAAGAAGACAGCAAGACCCTAGTCCTGGTTCTAACTTAGGTGGC

GGTGATGATCTCAAACTTCGTTAAGTGGAGCACAGCTTATGTGCCCCATCTCTACACACACTGCTTCTAGTTGGTATAAATAACTCATTGGGCGACCAGA

AACTGTGACAACTGGAGGGACTGCAGTTGGTTTCATGGCCTGAGGCAGTGAAGACGTCACCCACTGCCATGGTTTTGCACTATAATGCCTGCATTTCTAA

TTTTTAAAATATGTAGCCAGTAATAATTTGAAATTTTTTTCTATGCAAGCTTATCTTGTTGGCATTATTTTAGTTGTATCGAAAGTATATACTTTCTTCA

TTTTAACTTAAAAGCTCATGTCATTTAGAAACAAGATAAGAAATTAAAATTTGTATCAGGGTTGCTTAACATTCTTTTATACTTTCAGACGAGTTGGTTA

TACAGCTTTCCTCCTTAGATAAGGGTTCTTGGTTTTTGTTTGTTTTCTCTACATCATTTCGTGTTTTTGTATTCTGCACCATTTTACAAATGAAGATGTG

TTTGCAGTTATTTTTTCCAGCTATAAACCTAGAATAGAGCTGTCTGCCACAGCCTCCTAAAACAAACGTTTACAGTTGTTAAAGCCACAGTATCCTTTCA

AATGCTGATAGTCACCCTATCCCCTTTAGACAAAAATTCACATTAGTATTAAATTTTGTCTCAGACCCTGTTTCAAGGTATATCTTGTAATCATGAGTTT

GGGTAGAGATGCTCTTCACAGGTGAGAATGCTCTACAGAAATGCCCAAAGAAGCCACAGACTGGCTTCTGTTTTATTCAGGGATTTTTTTTTTAATCAGT

CAGAAAAAGGATACTGGAACTTGTTGTATGTAACAGCATATTAAACTGGAGGCAGTGATAAATCAGCTACACAGGTAAATTGTGTTAAAATAATGTTTAA

GATAGCTGCTTTCATGTGTATTTTGTATTTTGTATTGCATGCTTTTGTAGAAACAAAATTGGGTGATGAAGATGAGTCTTAGAAAATGTTCATCTGGGCA

GAAGATGCATTTCTCCCATTGATTCCGGGCAAAACATTCACAGATATAGATGATGGTATTTTACAAAAGGACTATTAATAGTGCCTTTTGAGATGAATCA

ATGTAACGATATTTTTAAAACAGGCTTAGTGTCAAATTGCAATTTTTTAAATATAAAACTGGAAAAAGTGCTAAGTCATTGGCACATGCTTACAATACTT

TCCGTGGTCGTATTCATTAAATGTTACTACATTTCTGAATTTTTGCAAAAATGTATTTTATCATAAAATGGCATTATTTTAGAAAATTTTAAAAACTGAC

ATGGTCAATTCAGAAAAGTCTGAATAAGGTCATTGCATTTAAAAAGCATATAAAGATACTTGATTGTGGAAGTGTGTCTTTCATTGTATATAGGTCTTAT

AATTCATAAACAAGTACCCTGTATCTCAAAATAAAAATATTTGTTATATATTTGAAGTCGTGCATGATAAGGATTGTGTTTGAATTATTATAAACAATAA

TGTGTTACAGAAGCTGATGCTGACCTTGTGTTACTGAGCACTATGAATGAATTTGCTTGGTATTTGGTGTTGTACAGCTCACATGTTTACACTCTCAGTG

CCCTGATGCCTCTCGGGAGTTACCTTTTTAAAGTGATCCTTTCTTTTTTAAAATAACATCTCGGTGGTACATTTTCTCTGTTGCTTCTCGCCAAGAGCTT

CCAGTCCGGCAGTCAGTAAGATCACATGGTGTTAATGTGGCCGTCCCTCTGTAAATAGCAAATGTTCCTTACTGGTTCTGCACTGCTTCTGTCTGTCTTA

ATGCTGGCGTTAAGATCATAAACTCCTTTTCTTCGGTAGTGCAGGCTTTGAAAATTAAGTTATTGATGCAATTTCATATTTTTCATAATCTGTATTTAAA

ATGACATCATTGCATCATTTTTTAAAGATTCATCTCCATTAAAACTTGCCTTAAGCTTCCAGATTGCTTTGCCGTTAGCTTTACTGTATATTTGTATGTT

TTATTTACTTTCACATTAAAATTCTGTGTACTGAAAAC
Translation
MPRVVPDQRSKFENEEFFRKLSRECE IKYTGFRDRPHEERQTRFQNACRDGRSEI - UNI26780 - AFVATGTNLSLQFFPASWQGEQRQTPSREY

VDLEREAGK - UNI33745 - VYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQ - UNI4091 - - UNI4967 - ARRQQDPSPGSNL

GGGDDLKLR
Transcript ENSMUST00000052209
Sequence
GAGAGGAAGTGGCGGCCGCAGCCGGGGGAGGCTGGAAGCTGTGTCTGCGCGGGCGGGCGGGAGGGAGGACGGCCGGCAACGGCTGAGGCGGGCGGCGGTA

GCGTGGGTTGGGCTCCAAGCACACGGCCGCACCTCAGCCTCCCTGGAGCGGGAGGCCACGCGGGCGGGCTCCTGAAACAAAGAGAAGCGGGAGTCCGGGT

GCCGCGGGTGGGCGGTCAAGGCGGTCAGCACCGGAGCCCGCCAGCGGGTGCCCGCGCGAGCCTGGGGAGCGCGGCCGGCCGGCGCGGCCTGAGGGCGGGA

AGATGCCGCGCGTCGTCCCGGACCAGAGGAGCAAGTTCGAGAACGAGGAGTTCTTCAGGAAGCTGAGCCGCGAGTGCGAG ATTAAGTACACGGGCTTCA

GGGACCGGCCCCACGAGGAGCGCCAGACACGCTTCCAGAACGCCTGCCGCGACGGTCGCTCGGAGATC - UNI26780 - GCTTTTGTGGCTACAGGA

ACCAATCTGTCTCTCCAGTTTTTTCCGGCCAGCTGGCAGGGAGAACAGCGACAAACACCTAGCCGGGAATATGTCGACTTAGAGAGAGAAGCAGGCAAG 

- UNI33745 - GTATACTTGAAGGCTCCCATGATTCTGAATGGAGTGTGTGTTATATGGAAGGGCTGGATTGATCTCCACAGATTGGATGGTATGGGT

TGCCTGGAGTTTGATGAGGAGCGAGCCCAG - UNI4967 - CAGGAAGATGCATTAGCACAACAGGCCTTTGAAGAGGCTCGAAGAAGAACTCGAGAA

TTTGAGGATAGAGACAGGTCTCACCGGGAGGAAATGGAG - UNI4091 - GCAAGAAGACAGCAAGACCCTAGTCCTGGTTCTAACTTAGGTGGCGGT

GATGATCTCAAACTTCGTTAAGTGGAGCACAGCTTATGTGCCCCATCTCTACACACACTGCTTCTAGTTGGTATAAATAACTCATTGGGCGACCAGAAAC

TGTGACAACTGGAGGGACTGCAGTTGGTTTCATGGCCTGAGGCAGTGAAGACGTCACCCACTGCCATGGTTTTGCACTATAATGCCTGCATTTCTAATTT

TTAAAATATGTAGCCAGTAATAATTTGAAATTTTTTTCTATGCAAGCTTATCTTGTTGGCATTATTTTAGTTGTATCGAAAGTATATACTTTCTTCATTT

TAACTTAAAAGCTCATGTCATTTAGAAACAAGATAAGAAATTAAAATTTGTATCAGGGTTGCTTAACATTCTTTTATACTTTCAGACGAGTTGGTTATAC

AGCTTTCCTCCTTAGATAAGGGTTCTTGGTTTTTGTTTGTTTTCTCTACATCATTTCGTGTTTTTGTATTCTGCACCATTTTACAAATGAAGATGTGTTT

GCAGTTATTTTTTCCAGCTATAAACCTAGAATAGAGCTGTCTGCCACAGCCTCCTAAAACAAACGTTTACAGTTGTTAAAGCCACAGTATCCTTTCAAAT

GCTGATAGTCACCCTATCCCCTTTAGACAAAAATTCACATTAGTATTAAATTTTGTCTCAGACCCTGTTTCAAGGTATATCTTGTAATCATGAGTTTGGG

TAGAGATGCTCTTCACAGGTGAGAATGCTCTACAGAAATGCCCAAAGAAGCCACAGACTGGCTTCTGTTTTATTCAGGGATTTTTTTTTTAATCAGTCAG

AAAAAGGATACTGGAACTTGTTGTATGTAACAGCATATTAAACTGGAGGCAGTGATAAATCAGCTACACAGGTAAATTGTGTTAAAATAATGTTTAAGAT

AGCTGCTTTCATGTGTATTTTGTATTTTGTATTGCATGCTTTTGTAGAAACAAAATTGGGTGATGAAGATGAGTCTTAGAAAATGTTCATCTGGGCAGAA

GATGCATTTCTCCCATTGATTCCGGGCAAAACATTCACAGATATAGATGATGGTATTTTACAAAAGGACTATTAATAGTGCCTTTTGAGATGAATCAATG

TAACGATATTTTTAAAACAGGCTTAGTGTCAAATTGCAATTTTTTAAATATAAAACTGGAAAAAGTGCTAAGTCATTGGCACATGCTTACAATACTTTCC

GTGGTCGTATTCATTAAATGTTACTACATTTCTGAATTTTTGCAAAAATGTATTTTATCATAAAATGGCATTATTTTAGAAAATTTTAAAAACTGACATG

GTCAATTCAGAAAAGTCTGAATAAGGTCATTGCATTTAAAAAGCATATAAAGATACTTGATTGTGGAAGTGTGTCTTTCATTGTATATAGGTCTTATAAT

TCATAAACAAGTACCCTGTATCTCAAAATAAAAATATTTGTTATATATTTGAAGTCGTGCATGATAAGGATTGTGTTTGAATTATTATAAACAATAATGT

GTTACAGAAGCTGATGCTGACCTTGTGTTACTGAGCACTATGAATGAATTTGCTTGGTATTTGGTGTTGTACAGCTCACATGTTTACACTCTCAGTGCCC

TGATGCCTCTCGGGAGTTACCTTTTTAAAGTGATCCTTTCTTTTTTAAAATAACATCTCGGTGGTACATTTTCTCTGTTGCTTCTCGCCAAGAGCTTCCA

GTCCGGCAGTCAGTAAGATCACATGGTGTTAATGTGGCCGTCCCTCTGTAAATAGCAAATGTTCCTTACTGGTTCTGCACTGCTTCTGTCTGTCTTAATG

CTGGCGTTAAGATCATAAACTCCTTTTCTTCGGTAGTGCAGGCTTTGAAAATTAAGTTATTGATGCAATTTCATATTTTTCATAATCTGTATTTAAAATG

ACATCATTGCATCATTTTTTAAAGATTCATCTCCATTAAAACTTGCCTTAAGCTTCCAGATTGCTTTGCCGTTAGCTTTACTGTATATTTGTATGTTTTA

TTTACTTTCACATTAAAATTCTGTGTACTGAAAAC
Translation
MPRVVPDQRSKFENEEFFRKLSRECE IKYTGFRDRPHEERQTRFQNACRDGRSEI - UNI26780 - AFVATGTNLSLQFFPASWQGEQRQTPSREY

VDLEREAGK - UNI33745 - VYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQ - UNI4967 - QEDALAQQAFEEARRRTREFEDRDR

SHREEME - UNI4091 - ARRQQDPSPGSNLGGGDDLKLR

For any suggestions or comments, please send an email to unitrap@crg.es