Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031889 (D230025D16Rik)
Chromosomal location
Chr 8: 107749099 - 107776949 (+)
Description
RIKEN cDNA D230025D16 gene Gene [Source:MGI Symbol;Acc:MGI:2443049]
RefSeq_dna
NM_145604 
RefSeq_peptide
NP_663579.2 
UniGene
Mm.27186 
MGI
MGI:2443049 
Uniprot/SWISSPROT
Q922R1 
Uniprot/SPTREMBL
Q3TKL5 Q6NXY4 Q6PER2 
Human Ortholog
ENSG00000125149 (C16orf70)
Omim not available
UniTrap UNI12013
Vector Insertion
Chr 8: 107749387 - 107755027
Public Clones (sanger) D085B11 (ggtc) E127F10 (ggtc) D086E12 (ggtc) E044H08 (ggtc)
P010E10 (ggtc) D111C11 (ggtc) CMHD-GT_473F9-3 (cmhd) PST21736-NR (escells)
IST12850D6 (tigm) IST14447B7 (tigm) IST14794C8 (tigm)
Private Clones OST448374 (lexicon) OST441531 (lexicon) OST324982 (lexicon) OST202423 (lexicon)
OST189355 (lexicon) OST30457 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6229
Vector Insertion
Chr 8: 107755111 - 107758381
Public Clones (sanger) CSG418 (baygenomics) E126G03 (ggtc) D185B01 (ggtc) E069H02 (ggtc)
D185D01 (ggtc) CMHD-GT_472C11-3 (cmhd) IST14499A1 (tigm) IST14639H12 (tigm)
IST10765E3 (tigm) IST11606C8 (tigm) IST13035D2 (tigm) IST14480H8 (tigm)
Private Clones OST452429 (lexicon) OST435907 (lexicon) OST405596 (lexicon) OST404012 (lexicon)
OST310490 (lexicon) OST310151 (lexicon) OST275231 (lexicon) OST274137 (lexicon)
OST246415 (lexicon) OST237921 (lexicon) OST197863 (lexicon) OST197646 (lexicon)
OST187649 (lexicon) OST175280 (lexicon) OST169533 (lexicon) OST131046 (lexicon)
OST67957 (lexicon) OST54669 (lexicon) OST33970 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15801
Vector Insertion
Chr 8: 107758466 - 107762322
Public Clones (sanger) E058H07 (ggtc) D054A12 (ggtc) E069E02 (ggtc) E046G10 (ggtc)
IST13660B12 (tigm) IST14641G2 (tigm) IST14513C6 (tigm) IST10730A4 (tigm)
IST10107E6 (tigm) IST12838F2 (tigm) IST14724A6 (tigm) IST14723E8 (tigm)
Private Clones OST472808 (lexicon) OST420930 (lexicon) OST330228 (lexicon) OST321903 (lexicon)
OST303242 (lexicon) OST235191 (lexicon) OST220573 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18327
Vector Insertion
Chr 8: 107762367 - 107763570
Public Clones 3SE167G02 (ggtc) 5SE167G02 (ggtc)
Private Clones OST425589 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23784
Vector Insertion
Chr 8: 107763651 - 107763877
Public Clones not available
Private Clones OST245078 (lexicon) OST67865 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32458
Vector Insertion
Chr 8: 107763973 - 107764740
Public Clones IST10890A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI71
Vector Insertion
Chr 8: 107765040 - 107770320
Public Clones GC0333 (tigem) IST10123H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19969
Vector Insertion
Chr 8: 107774692 - 107775497
Public Clones not available
Private Clones OST376215 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034361
Sequence
CGCTGCTGTTGCTACAGCCTCTCCTGCCGGGGCTGCTGCCCGGGAGGTTGAAGGGAGGTGAAGTGTGTTGTTGTGTTCGTGCTGCCGTCGCCGCCCGGAA

CCGAGTGGAGAGCCGGACGTCCGCGGGCTGGCGAGAGCGACCAGTCAGCAGCTGCGTGCTCTCCTCAGGCCGGGTCCTGTCTGCGCTGCCGCAGGGAGGC

CGCCCGGCCCAGCGAACCGACCCAATGCTGGACCTGGAGGTGGTGCCTGAACGCTCTCTGGGGAACGAGCAATGGGAATTCACTCTGG - UNI12013 

- GAATGCCTCTGGCGCAGGCGGTCGCCATTCTTCAGAAGCACTGTCGCATCATCAGAAACGTCCAGGTTCTCTACAGTGAGCAG - UNI6229 - TC

TCCTCTAAGCCATGACCTCATCCTTAACCTGACTCAGGACGGGATCACACTACTGTTTGATGCTTTCAACCAGAGACTCAAG - UNI15801 - GTGA

TTGAAGTTTGTGAGTTGACAAAAGTAAAGTTAAAGTATTG - UNI18327 - TGGAGTGCATTTTAACTCTCAGGCCATCGCTCCTACCATTGAGCAA

ATTGACCAGTCTTTTGGCGCAACCCATCCTGGAG - UNI23784 - TGTACAACTCTACTGAGCAGCTCTTCCACCTCAACTTCCGAGGACTGTCTTT

CTCTTTTCAGTTAGACTCGTGGACGGAGGCTCCCAAGTATGAG - UNI32458 - CCCAATTTTGCCCATGGTCTAGCTTCTCTTCAGATACCCCATG

GAGCAACTGTAAAACGAATGTACATCTATAGTGGGAACAGCCTCCAGGATACCAA GGCTCCTGTGATGCCCTTGAGCTGTTTCCTGGGGAATGTATATG

CTGAAAGTGTAGACGTTCTTCGAGATGGAACTGGACCCTCAGGGTTGCGACTTCGCTTGCTCGCTGCAG - UNI71 - GTTGTGGACCTGGAGTGTTA

GCAGATGCCAAAATGAGAGTATTTGAGCGTGCGGTGTATTTTGGTGATTCTTGCCAAGATGTTCTTAGCATGCTTGGCTCTCCACACAAAGTCTTCTATA

AATCTGAAGACAAG ATGAAAATTCACTCTCCTTCCCCTCATAAACAAGTTCCGTCCAAGTGCAACGACTACTTTTTTAACTATTTTACTCTCGGAGTG 

GACATCCTGTTTGATGCAAATACACACAAAGTGAAGAAGTTTGTCCTGCATACCAATTACCCTGGGCATTATAATTTTAACAT TTACCACCGCTGTGAG

TTCAAGATCCCACTGGCCATAAAGAAAG AAAATGCAGGTGGTCAGACTGAAATATGCACAACCTACAGCAAG TGGGACAGCATCCAGGAGCTTCTGGG

CCATCCTGTGGAGAAGCCTGTTGTCTTGCACAG GTCCTCATCCCCAAATAACACCAATCCGTTTGGCTCCACATTCTGCTTTGGTCTTCAGCGGATGAT

CTTTGAG - UNI19969 - GTCATGCAGAACAACCACATTGCCTCAGTGACCCTGTATGGCCCCCCCAGGCCTGGTGCCCACCTGAGAACAGCAGAGC

TGCCCTAAGGACATCACTGTTTTCCCTGTCCATGGAACTGTGCGTCACATCCAGCTCAGTGGGTCTCTGTGCCACCCTGTGTGTTTGCTTGGACACCTTG

GCAGTGTTGAAGGGCCCTGGGACTCAGAAGGGTTTGGAAGTAGGATTTGGGCTGAGTCCTCTGCCGTGGGACGGAGGACCCAGATACTCTGTCCTAAGCC

TGCTGTTGCCAGGAGAGAACACAGTGTGCAAAAAGAAGCACAAACTTAGAGCCATGATGAGGGCTCTCATAACTAACATGTAATAAAGGACACGTCAGCC

CCTGCCCTGCTCACATAGGGAAGACAGGACTCTTTCTCTAGCTAAGAAAATATTCCCAGGATGAGAACAGGCTCCTGCTTTTGGCCCGACATTGCCACGT

GGCCCCTAAGGTGAGCAGAGCAGGTAGCATGTCGGTAGTACTTGGTTGCAATATTTGCACTCCATCCACTTTAGTGACTTGATGAGCTGGCTGTGGCTGG

TGTGGCCCACTGCCCTTCCCTGCTTCTCCTGTGAGTGCTCCTTGCCGTGCCCAGGTGGCACCTAAGTGGATGAAATCGTTTCCTACCAGGTATGTACCAG

GCCTGGTTCCCACTGCTGCTCTGGGAGCCAGCCTTTAAGGTCACCTGTGTCTCTTGGTCCAACCTGGCTGACAGGGCTGCATGTCTCCATCTTGTTTGCC

TCTTTTATTTAATGCCAAAGTGTTAGCCAAAGACACCTTCCTCCTTTTGTTACATTACAGCATTCTGTTATGCACTGTGGGCCAGCTCCTTGCCCTAGTT

CTGGGCACTGGCCTGGCCTGGCCTGGCTACTTGGTTTGAGGCCTAGAGGCTCAAGGAACACTAGGCTGCTTGGTTTCTTACATGGGTCTTGCTAATGGGA

AGTAGCATATATGTGCTTTAAAATAGTAATCCTTTTGAAAAGAATTGAGAAGAGAAACATATAATTTTATCCCATTTTTAATATTTTGGTCTAGCAACTT

GTGATACATAGATGACAATTTTGTGAGTTTTTCAAATGTGTGTACAGATTTTTGTAAATAATGACTTTTGTAATTAACTCATGTACAGCCTCATCTTGTA

TAGTTCATGATGAATGTGCAGGGGACCTGCCCCAGCTGTCTGTATGGTTCCTGGGCCTACAGCCAGGCCTGTGTGGCACTCCCATGACTGATTTGACAGG

TGTCTTCCCATTTGGACCTTCGTCTGGCCAGAGACCCTGCACATCCCACTGTCAGGGTAGCCAGGACTCTTCCCATCCTCGTGATCAGAGGAGACTTCCT

CGTCCCCCTTCCAATAAAGCACCTATGCCCACAGTGACAGCGTGCCATGTGCTGCCACTGGGCTGTTTGTACT
Translation
MLDLEVVPERSLGNEQWEFTLG - UNI12013 - GMPLAQAVAILQKHCRIIRNVQVLYSEQ - UNI6229 - SPLSHDLILNLTQDGITLLFDAF

NQRLK - UNI15801 - VIEVCELTKVKLKYC - UNI18327 - CGVHFNSQAIAPTIEQIDQSFGATHPGV - UNI23784 - VYNSTEQLFH

LNFRGLSFSFQLDSWTEAPKYE - UNI32458 - PNFAHGLASLQIPHGATVKRMYIYSGNSLQDTK KAPVMPLSCFLGNVYAESVDVLRDGTGPSG

LRLRLLAAG - UNI71 - GCGPGVLADAKMRVFERAVYFGDSCQDVLSMLGSPHKVFYKSEDK MKIHSPSPHKQVPSKCNDYFFNYFTLGV DILFD

ANTHKVKKFVLHTNYPGHYNFNI IYHRCEFKIPLAIKKE ENAGGQTEICTTYSK WDSIQELLGHPVEKPVVLHR RSSSPNNTNPFGSTFCFGLQRM

IFE - UNI19969 - VMQNNHIASVTLYGPPRPGAHLRTAELP

For any suggestions or comments, please send an email to unitrap@crg.es