Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031897 (Psmb10)
Chromosomal location
Chr 8: 108459642 - 108461987 (-)
Description
proteasome (prosome, macropain) subunit, beta type 10 Gene [Source:MGI Symbol;Acc:MGI:1096380]
RefSeq_dna
NM_013640 
RefSeq_peptide
NP_038668.1 
MGI
MGI:1096380 
Uniprot/SWISSPROT
O35955 
Uniprot/SPTREMBL
Q3UNP9 Q4FJX8 Q91VC5 Q920I3 
Human Ortholog
ENSG00000205220 (PSMB10)
Omim not available
UniTrap UNI34046
Vector Insertion
Chr 8: 108461140 - 108461492
Public Clones IST14243D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22863
Vector Insertion
Chr 8: 108460655 - 108460765
Public Clones not available
Private Clones OST282702 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25588
Vector Insertion
Chr 8: 108460048 - 108460595
Public Clones not available
Private Clones OST175174 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16463
Vector Insertion
Chr 8: 108459806 - 108459895
Public Clones not available
Private Clones OST460719 (lexicon) OST195077 (lexicon) OST29135 (lexicon) OST22840 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034369
Sequence
CCAGGACAGACGCCTCTGCTCCCCCTGGCTGATCCACTCATCGAGACCCCCGCATTCTCACTTGGCCTTCCTGCGAGATGCTGAAGCAGGCAGTGGAACC

CACAGGAGGCTTCTCTTTCGAGAACTGCCAGAG GAATGCGTCCTTGGAACACGTCCTTCCGGGACTTCGGGTTCCTCATGCACGCAAGACCGGGACTAC

CATCGCGGGGCTTGTGTTCCGA - UNI34046 - GATGGAGTCATCCTGGGAGCGGACACGCGGGCCACTAACGATTCGGTTGTGGCGGACAAAAGCT

GCGAGAAGATCCACTTCATCGCCCCTAAAATCTA - UNI34046 - CTGCTGTGGGGCTGGAGTAGCTGCGGACACTGAGATGACTACGCGGATGGCA

GCTTCCAAGATGGAACTACATGCGCTGTCCACCGGCCGTGAGCCTCGGGTGGCCACGGTCACCCGTATCCTGCGCCAGACGCTTTTCCG - UNI34046

 - GTACCAAGGCCACGTGGGGGCATCACTGGTCGTGGGCGGGGTTGATTTGAACGGACCTCAGCTCTACGAGGTGCACCCACATGGTTCCTACAGCCGT

CTGCCCTTTACTGCCCTTG - UNI22863 - GCTCTGGTCAGGGTGCAGCCGTGGCACTGTTGGAAGACCGGTTCCAGCCAAACATGACG - UNI25

588 - CTGGAGGCTGCGCAAGAGCTGTTGGTGGAAGCCATCACAGCAGGGATCCTGAGTGACCTGGGCTCTGGGGGCAATGTGGATGCCTGTGTGATCA

CTGCAGGGGGTGCCAAGCTGCAGAGAGCATTGAGCACCCCCACCGAGCCTGTGCAGAG - UNI16463 - AGCTGGCCGTTACCGATTTGCTCCTGGA

ACCACACCTGTCCTGACCCGGGAAGTGAGACCCCTGACCCTGGAACTTCTTGAGGAAACTGTGCAGGCCATGGAGGTGGAATGAAGTGGCCTGAGATGTA

GAGTTTGGAATGAGGGTGAATAAATCCGGGAAACAC
Translation
MLKQAVEPTGGFSFENCQR RNASLEHVLPGLRVPHARKTGTTIAGLVFR - UNI34046 - DGVILGADTRATNDSVVADKSCEKIHFIAPKIY - 

UNI34046 - YCCGAGVAADTEMTTRMAASKMELHALSTGREPRVATVTRILRQTLFR - UNI34046 - RYQGHVGASLVVGGVDLNGPQLYEVHP

HGSYSRLPFTALG - UNI22863 - GSGQGAAVALLEDRFQPNMT - UNI25588 - LEAAQELLVEAITAGILSDLGSGGNVDACVITAGGAKLQ

RALSTPTEPVQR - UNI16463 - RAGRYRFAPGTTPVLTREVRPLTLELLEETVQAMEVE

For any suggestions or comments, please send an email to unitrap@crg.es