Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031910 (Has3)
Chromosomal location
Chr 8: 109394142 - 109406802 (+)
Description
hyaluronan synthase 3 Gene [Source:MGI Symbol;Acc:MGI:109599]
RefSeq_dna
NM_008217 
RefSeq_peptide
NP_032243.2 
UniGene
Mm.56986 
MGI
MGI:109599 
Uniprot/SWISSPROT
O08650 
Uniprot/SPTREMBL
B2RR08 Q8CEB9 
Human Ortholog
ENSG00000103044 (HAS3)
Omim not available
UniTrap UNI14765
Vector Insertion
Chr 8: 109394315 - 109397807
Public Clones PST15517-NR (escells) IST10545E11 (tigm) IST14856F3 (tigm) IST12400B5 (tigm)
IST12250C7 (tigm) IST15042D10 (tigm) IST14568E12 (tigm) IST14591A2 (tigm)
IST13509H7 (tigm) IST11867H1 (tigm) IST14919E9 (tigm) IST14985B9 (tigm)
IST10737G5 (tigm) IST11773E12 (tigm) IST15074A1 (tigm) IST14197H5 (tigm)
IST14899G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38191
Vector Insertion
Chr 8: 109398447 - 109400791
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32846
Vector Insertion
Chr 8: 109400894 - 109401804
Public Clones IST14097H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034385
Sequence
AAAGCTCAGCTTGTCATAATAGTTAACACCTTCTTTGACCAGCCTCCTTTTATTTGACAATTTTTCTTTTCTGTCCCTCTCTGTTGCCACCGGGAAGGTT

TTTAGGGAGTCCCCTCACATAGCGAGCCGCCCCTTGGCGTTCAGAAGATTTTCTGGGGTAGCCCGTTTGCAGG - UNI14765 - ATGCCGGTGCAGC

TGACTACAGCCCTGCGTGTGGTGGGCACCAGTCTGTTTGCCCTGGTAGTGCTGGGAGGCATCCTGGCGGCCTATGTGACAGGCTACCAGTTTATCCACAC

AGAAAAGCACTACCTGTCCTTTGGCCTCTACGGTGCCATCCTGGGTCTACATCTGCTCATCCAGAGCCTGTTTGCCTTCCTGGAGCACCGTCGAATGCGC

AGGGCAGGGCGCCCCCTCAAGCTGCACTGCTCCCAGAGGCCGCGTTCAGTGGCACTCTGCATTGCTGCCTACCAAGAGGACCCCGAATACCTGCGCAAGT

GCCTTCGCTCAGCTCAGCGCATTGCCTTTCCAAACCTCAAGGTGGTCATGGTAGTGGATGGCAATCGCCAGGAAGATACCTACATGTTGGACATCTTCCA

TGAGGTGCTGGGTGGCACTGAGCAAGCTGGCTTCTTTGTGTGGCGTAGCAATTTCCATGAGGCGGGTGAAGGAGAGACAGAGGCCAGCCTGCAGGAAGGC

ATGGAGCGTGTGCGAGCTGTGGTGTGGGCCAGCACCTTCTCATGCATCATGCAGAAGTGGGGGGGCAAGCGTGAGGTCATGTACACTGCCTTCAAGGCCC

TTGGCAACTCAGTGGACTACATCCAG GTGTGTGACTCTGACACTGTGCTGGACCCAGCCTGCACCATTGAGATGCTTCGAGTCTTGGAAGAAGATCCCC

AAGTAGGAGGTGTTGGAGGAGATGTCCAA - UNI32846 - ATCCTCAACAAGTATGATTCATGGATCTCCTTCCTGAGCAGTGTGAGGTACTGGATG

GCTTTCAACGTGGAGCGGGCCTGCCAGTCCTACTTTGGCTGTGTGCAATGTATTAGTGGGCCTTTGGGCATGTACCGCAACAGCCTCCTTCAGCAGTTCC

TGGAGGATTGGTACCATCAGAAGTTCCTAGGCAGCAAGTGCAGCTTTGGGGATGATCGGCACCTTACCAACCGAGTCCTGAGTCTTGGCTACCGGACTAA

GTATACAGCACGCTCTAAGTGCCTCACAGAGACCCCCACTAGGTACCTTCGATGGCTCAATCAGCAAACCCGCTGGAGCAAGTCTTACTTTCGGGAATGG

CTCTACAATTCTCTGTGGTTCCATAAGCACCACCTCTGGATGACCTATGAATCAGTGGTCACAGGTTTCTTCCCATTCTTCCTCATTGCTACAGTCATAC

AACTTTTCTACCGTGGCCGCATCTGGAACATTCTCCTCTTCCTGCTAACAGTGCAGCTGGTGGGCATTATCAAGGCTACCTATGCCTGCTTCCTTCGAGG

CAATGCAGAGATGATCTTCATGTCCCTCTACTCCCTTCTCTATATGTCCAGCCTCTTGCCAGCCAAGATCTTTGCTATTGCTACCATCAACAAGTCTGGC

TGGGGCACTTCTGGCAGGAAAACCATTGTCGTGAACTTCATTGGCCTAATCCCCGTGTCCATCTGGGTGGCAGTTCTTCTAGGGGGGTTAGCCTACACAG

CTTATTGCCAGGACCTGTTCAGTGAGACCGAGCTAGCCTTCCTAGTCTCTGGGGCCATCCTGTATGGCTGCTACTGGGTGGCCCTCCTCATGCTGTATCT

GGCCATTATTGCCCGGAGGTGTGGGAAGAAGCCAGAACAGTATAGCCTGGCTTTTGCGGAGGTGTGATATAACCTCCAAGTAAAGTGGGAAATGTGCAAT

GGGTAAGGGAGGGAATGGAAAAGATGGGGTGGGAGGGAGGAGGGTGTGTTGTGTTCTAGTTTCATGGCTGAAAGGACCGATCTGAAACGCAAAGAATAGT

GACTGTGGTATGGCCTGGGTAGCTCTGCTCAGCAGAAGCATGGCATTGGGCAGATGGGCTTGTATGTTTCTAGGCTGCTCATCTGCCTGCCCTTGCACAG

GTAGTGAACTCTTTGAAATGATTTTACTTCTTCCTGGGAACTATTGAGAACCCAGAAGTGTGCTAAAATAAGTGCTAAATTCCATCCTATGTCAACTTCT

GGTACAGAAACAAGCAATGACAGCTCATAGAATATATCCTCCTAGCCCAGCTGAACATGACAAGGAGTTCCTGTCAAGTGTTACTGTCCCATACCGGCTA

CTGTCCCATTTCCCTAACCTCCGATTAGCCATCAATGCGTTAAGACTGTGCCTGAGATAATGAGGCTGGGAAGCCTGACCTTTGGTCAAAAAACAGGGTC

TAAGAAATGGTGCTTTATGTAATTAATATATTCCACTCCACACCAAAACATCCCAGGGATGAGCCAAGTCACCAGAAGTAAGGAATGAGTCTGGTGGGGA

TTTTATCTGTTTTGGGTGCACAGTACAAAGCAAAGTCTGCAATGCACCAAACAAAAGCCGCCCAGTTGTTCTGCTGCACATTTGTCATCCCAGCACTTAG

AAGCAGAAAGAGATGAGAGGGTCAGGGTTAGGCTAGACTACATGAGATCCTGACTGTCTCATACAAAAATGGTTTGACGGGAGGATCAAAGATTGCGTTG

GTGCTAAAAACCATGGATGCCTTGGAGTGAATGTGTTCCAACTGAAAACTGCTTGGTCTTTTACAAAATTCCCCAAGTTGTCAAGAGAACTTGCTGGGCA

GACTGGATGTTTTAGCCATCTACCGGGAAGACTCAACCCCAGTGGATTCAGATAAGAAGTCTTTAGTTATTCTAGCTCATTCCTACCTGAATGCCTCTCA

CATATGGCTCTCATCCTGCTTGCTATTTCAATCTCTTCAGAGCCGCGCATGTCGCTTAGTTGTTGTTTTCTGGTGGGGAGAGCAGCAGTTACCTCTTCAT

TTTCATGGGTAAATTCCCATGTGACCATGGTAGAGAATAGACGCTTACAAGGCTTTCAAGGCTGTTCCCTACATGCATGGACGTAACAACAGCCTCTGGC

CACACTGTTCATCGTCCAGGACTGGTCAGGACTTCGGCAGCTGGTTAGTTAGCATCTGTAACTTTCTCGACAATCATTCCCAAAGGAAAGCTTTCTGGAG

TTGCCCAAATGAACCTTCAGATCCATGTTGGTCATCTTTGAGAGCATCCATTCTCAGTGGCTTCTCCAAGGAATTCTACGGCTAGAATAGTAGATGCACC

TCCATTTGCTGCTTCAGTCCAGAAACCAAAGTAGGAGCTGGAACCGGTCCAACAGTCTTCAGTCCTCTTACAGCCCTCACTGGCTGCCGATTTCCTTGTT

TCTCTTGAGGAACGAGGAGAAGCTTTTACACTCTTTTGAAGTCAAGACCAGATTGCTTTGGCATTGAAGCGTGGGCTCGTGACTAAGCCTTTGACTTTGT

GGGCTACTTACAATTTCCCTGAACATTTGTTCTCTGAGGGACCAGCTAACCCTCAGAAGCAACTGGGTTGGAGAGCAGTGTACATAGGTGCTTCCTACAA

AAGAATGAAGTGCACTCCAAACCACCAATGGGCCATCCCTTGTATTTCCCTTCCTCGTATGAACAAAAGGGGTTTTCCAGGTGTAGCTAACAGTTGCCAC

AGCACACAAACCTCAAGTTGCTAGGAAAACTGCTGGCTGGTGTGAGGCCCAACTCATGGTGGCTGAGGAGCAGCAGCCGTTTGTGACAGGCAGTTGCTCT

GGGGCCTTCTGTTAAGAAGTGAACTATTTGAGCACTACAGTGGAGACAATCCAGTCAACTTCGGGGCTCAGACTAAGGGCTTGTTTTTCTTCAGCTTTTA

CTTGAAGGTTACAGGACAATGGACTCTGGATGAAAACTGGTTGTCTACCGTCAGCTCTCTGCCTTGCACTGTGGTCAACTCTCCTCAGATTAAAGATGCA

GGTACAGTAGTGAGCTTACAACATTTGACCTCGACTGGATTTCCTAATTTATTTTATAAGCAGCAAAACTAAACTGGGTCTACAGCTATATCCCTGTTTC

TTGCAAGGGAAGAGCCTTTATACAATTAGACTCATTTTGGTTTTCCTCATTGACAATTTCAGCCTCTTTTGTATTATTTCTACAATAATTTGTATATATT

TTTTCCTGCTTTTTTATTAAATAAGGAGGGAACTTTATTTAACATTAAGGGTGGGAGGGAATCAGAAAGGAGGATAATATTCATATCATGCTCTTGGCAC

AGCCACTGAGCACAATGCACAGGCCTCGTGACTCTTAAGCAAAGTCACAGTGTACAGGTGTGCAGCTGGAGCTCATCTTCTTCAGCTAAGCTTTTATCCG

CGGTTCTACCTTCACCTTGCCTATGACCTGCAAAGTCCAGGAGGTGCCCCTGTTCCTCCAGGTTGCCAGACAGGTCATAGGAACACCTCAGAAAGTGTAG

AACTCTACCAGGACCCTTCTCAGAATGATCCTTCTCTGCTTCACAATCTCTGCCATCTTTCTCACCATTCCTACAAGCTGTAGTCAGTGCAGGTGCCACA

GCCAATGTCCCCTCAACCATCCCCCCAACCCCCCCAGCCTTTACAGCTTCCTCTCTGCCTTGTCCTTCTACAACTCTGGGCCTCTTGAAAGCAAAGCCCC

CCCCCCCCCCCCCGTTGTCATTCTCTTTGCTGATGTCCATGTTCTCACTCCAGCATCAACTAGTGGGGATTCAAGCTGAGGACCACGGCTCTGCCTTTTC

CAGGACCACCTCTGCACTCTGGGTAGTGGTGCTGAGCTTTGCCCAGCAGTATGAAACCTAAGTCCCTCTCTTGAATCTAATGCTCAGGAGGTCGTATCTC

ATCTTCTGGCACCACCACCTCAAGAGTGAGATACTTAGAGGTGAGCTGAAGCCCTGCTGAACTTGTAGTTGCAGGATGACCCAGCTCTCAGCCAATTCTC

ATTCATGAGGCCACTGGTGGTCACCCTAGTTCTATGGAAGGTGTCTAGCCAGTTCCTCCAGTTCCCATCTTATTTAGCTTTTGCTGTGCCGAGGCCACCT

GCACAAGGCAGCTGTTAGGGCACAGCTCTTGGCCAGCTTCTTATGCACCGGGTTCACATTCACCAGCAGTGCATTCTCCTCTTCTTGCAATACTCCTTTT

GTCCTTAAAGGTGAAGGTCAGTCTCTCCTTTGTATTAATGACATACTTCTCAGTGAGGCCCTACAGGTCTCAAGCGCCATGCATCAGTGTGCTGATGCCT

AACTTCTGGTCTATCTCCTCCAACAGCTTAGTCCTCTTCTCTGCCAAGACCTTCTGTAGCTCTTCATTATCCCAGCTGTGGTGTTCCCAGGGCTGGGGTC

ATTCTCCTCTAACTTCTGAGTCAGGAGTACTGTCCCTGTGGCTCTTCTTGAAAGGCCATGGGAGCTAAAGTTGGATATTACAAACCCGTCTTTCTTAATA

GTGACTTTCAAGAGTTTCAACATCAATTTGGCTGTAACTGACTGTTTCAAAGAGCATCTCCTACTTTGTAGCTGCCCAGAATACTGTGCAGTGCCATTAG

AGACCTGAGTTTCTGTCACCCCGTAGCCCCACCTGTTGTCCACTGTAGGTGCCATTCCGGTGCTGTTTTTTGTACTCCAAATGTTGCTGTGGCAGCTTGA

TGACTCCTTAAAACTAAGTTGGCCTCACTGGGCTGCCACCAAGTCCTGACACAAAATGCAGACAATTTTGGGTGACAAGGCAGCCGCTATCCTGTTGCTG

GCAACCATGAGCAGCTGCTCCTGGCTCCATTGTTTTCGTTGCCCTTGGAGACTGGCTTTTTTTGTTGTTTATCAGGTCAAGAATTTTTTTTTATTGCACT

TATCAAAATAAAAATTCTTACATAACTCTGGCGTGTCCATT
Translation
 - UNI14765 - MPVQLTTALRVVGTSLFALVVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGRPLKLHCSQRPR

SVALCIAAYQEDPEYLRKCLRSAQRIAFPNLKVVMVVDGNRQEDTYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMERVRAVVWASTFSC

IMQKWGGKREVMYTAFKALGNSVDYIQ VCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQ - UNI32846 - ILNKYDSWISFLSSVRYWMAFNVE

RACQSYFGCVQCISGPLGMYRNSLLQQFLEDWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTRYLRWLNQQTRWSKSYFREWLYNSL

WFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVGIIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSG

RKTIVVNFIGLIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCGKKPEQYSLAFAEV

For any suggestions or comments, please send an email to unitrap@crg.es