Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031916 (Cog8)
Chromosomal location
Chr 8: 109570195 - 109580584 (-)
Description
component of oligomeric golgi complex 8 Gene [Source:MGI (curated);Acc:Cog8-001]
RefSeq_dna
NM_139229 
RefSeq_peptide
NP_631975.3 
UniGene
Mm.288641 
MGI
MGI:2142885 
Uniprot/SWISSPROT
Q9JJA2 
Uniprot/SPTREMBL
Q3U184 Q3U5F9 Q8BFW5 
Human Ortholog
ENSG00000213380 (COG8)
Omim 611182 - CONGENITAL DISORDER OF GLYCOSYLATION, TYPE IIh  
UniTrap UNI37167
Vector Insertion
Chr 8: 109578130 - 109580160
Public Clones CMHD-GT_487E12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI879
Vector Insertion
Chr 8: 109574211 - 109576112
Public Clones CA0053 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33565
Vector Insertion
Chr 8: 109572608 - 109574211
Public Clones IST10901D4 (tigm) IST14132G3 (tigm) IST13983A4 (tigm) IST10719F2 (tigm)
IST14846A2 (tigm) IST11568E5 (tigm) IST14817A4 (tigm) IST15077H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034391
Sequence
AGAGGAAGTGACGGTACCGTGCTTGAGAGATGGCGGCCGCTCTCCCTCTCCAGCCCTCCACGACCGCTTCGGCCACGACGACAGCCACGGCCGTCGCGCT

GGGGGAGGTGGAAGATGAGGGCCTCCTGGCGTCGCTATTCCGGGACCGCTTCCCCGAAGCTCAGTGGCGTGAGAAGCCCGACGTGGGCCGCTACCTCCGG

GAGCTGAGCGGCTCCGGGCTGGACCGGCTGCGGCGCGAACCCGAGCGCTTGGCGGAAGAGCGGGCCCAGCGGCTGCAGCAGACGCGCGACCTGGCTTTCG

CCAACTACAAGACGTTCATTCGCGGGGCCGAGTGCACCGAGCGCATCCACCGGCTCTTCGGCGACGTGGAGGCGTCCCTCGGGCGCCTGCTCGACCGTCT

GCCCCGCTTCCAGCAGAGCTGCAG - UNI37167 - GAACTTTGTGAAGGAAGCTGAGGAGATCAGCTCCAGCCGCCGCATGAACACGCTGACTCTAA

ACCGGCACACAGAAATCCTGGAGATTTTAGAGATACCCCAGCTTATGGACACGTGTGTCCGAAACAGCTATCATGAAGAGGCGCTGGAGCTTGCCGCCTA

TGTACGGCGACTGGAAAGGAAGTACTCCTCCATCCCCGTTATCCAG GGCATTGTGAATGAAGTGCGCCAGTCCATGCAGCTGATGCTAAGCCAGCTGAT

CCAACAACTGAGGACTAACATCCAGCTCCCAGCCTGCCTCCGTGTCATAGGCTATCTTCGGCGCATGGATGTCTTCACTGAGGCTGAGTTGAGGGTGAAA

TTTCTTCAGGCTCGGGATGCTTGGCTCCGCTCCATCCTGACTGCCATCCCTAATGATGATCCTTACTTCCACATCACAAAAACCATTGAGGCTTGCCGGG

TCCATCTCTTTGATATCATCACCCAGTACCGTGCTATTTTCTCAGATGAGGACCCCCTGCTGCCACCTGCCATGGGCGAGTACACTGTGAATGAGGGTGC

CATCTTCCATGGATGGGTGCTGCAGAAAATCTCACAGTTCCTGCAGGTGCTAGAGACTGACCTTTACCGGGGTATAGGAGGCCGCTTGGACTCTCTGCTT

GGCCAGTGCATGTACTTTGGGCTGTCCTTTAGCCGGGTGGGGGCTGATTTCCGCGGCCAGTTGGCTCCTGTTTTCCAGAGGGTGGCAATCAGCACTTTCC

AGAAAGCAGTTGAAGAAGCAGTGGAGAAATTCCAGGATGAAATGACTTCATACACCCTCATCTCGACTGCAGCCATCCTGGGCAGCAGTAACACGCCTGC

CACAGTACCAGCCACACAACCAGGCACGCTGCAGCCACCGATGGTGCTCTTAGACTTCCCGCCTCTTGCCTGTTTCCTCAACAACATTTTGGTTGCTTTC

AATGATTTACGTCTCTGTTGCCCTGTGGCTCTAGCACAGGATGTGACTGGGACCTTGGAAAATGCCCTTACCAAG - UNI879 - - UNI33565 - 

GTAACCAAAACAATTCTGGCATTCCATCGAGCCGAAGAGGCTGTGTTCAGCAGTGGGGAGCATGAGATCTTTGTCCAGTTCTGCACTGCCTTCCTGGAAG

ACCTTGTTCCTTATTTGAACCGCTGTCTTCAAGTCCTTTTCCCACCAGCTCAGATAGCCCAGACTTTAG - UNI33565 - GCATTTCACCCACCCAG

CTCTCTAAGCACGGAAACCTTGGACACGTGAACATCAGCGCCATCCAGGAACCTCTCGCCTTTATTTTGCCTAAGAGAGAAACAGTTTTCTGTTTAGATG

AGCAGGAGCTGGGGCCGGACCTCGTGGCCCCAGCTCCAGAGCTCCCTGCGGAGCAGCGGAGCATGGAGCCTGTAACAGAGAAGAGGGAACCAGGGGAGCC

GCTGCCTCAGGAGCCCATGGAGGGGGAGCCGCTGCCAGCCGAGCCACCGAGTGAGGGAGGAGCCATAGGCAGTGTCCCCTGCCCGCAGCCTGGGGAGCAG

CCCTGAGGGTACGCGCTTCTGCAGCGGGAAG - UNI33565 - GACTGGACCCAAAAGGAGAGCCAGTGGTGTGGTCGGCAAGTGGTTGGACAGCTCG

AATCATCCAGCATGAGATGGATCACTTGCAGGGCTGCTTGTTCATCGACAAAATGGACAGTGGGACATTTACCAATCTCCACTGGATGGAGGTGAATGAC

TAACACTCTCCTTGAATTGAGGATCTGGAAATCCAGCATGCAGACTAAGATGGTCACATCTGTGCTTCAGCTTGGAATTGGTTCCAGTCCGACAGTAGAC

AGTGTGTGCTGGTCTGAGATGAAGATGATAGAAATGCTTGCCCTGAAATCAGATCTGACAGAATACGATTACAGCAGGACTACAAATGTACCATTAAAGG

AGTGGCTATTTCCTGACAATTTCCCATGGAGAGGAGTGGGCAGGCAAACATCCTCTGTACAAATGAGACACATTCTAACCCCACAGCCTACAATTGATTG

ATAAGGTAATCCAGATATCCAAAAGATTTGTTTTTTGAAACAGGGTTTCTCTGTGTAGCCTTGGCTGTCGTGGAACTCACTCTGTAGACAAGCTGGCCTC

AAACTTAAGAGATATACCTGCCTCTGTACTCCTGAGCTTTGGGACTGAAGGTGTATCACACTACTGCTGGACTTGAAAGTTGTCTTAAAATGCAGTCTTA

AAAGTCTGAGTGTGGTGGCACACCTTTAATTCCAGCACTCTGTTGGCAATCGTAGGCTAATGTTTAAGGCCATCAAAGGAACATAGTAAGATTCTCTTAA

AAGAAAAAAAAAGCTCAAGTCTGGGGTGATAGCTAGGCAGTTAGGTTAAAGAGTGCTTGCTTTTTTTGCACAACACTAGAGTTCAGTTCTGAGCATTTAC

ATCAATCAACTCACTACATCTATACCTCCAGCTCCAGGGAATTAAGTGCCGCCTCCTGGCCTCTGCAGGTATTGTTTTGTGTATAAACTTACACAGAAAC

ATAATTGAAATAAAATCTAAAG
Translation
MAAALPLQPSTTASATTTATAVALGEVEDEGLLASLFRDRFPEAQWREKPDVGRYLRELSGSGLDRLRREPERLAEERAQRLQQTRDLAFANYKTFIRGA

ECTERIHRLFGDVEASLGRLLDRLPRFQQSCR - UNI37167 - RNFVKEAEEISSSRRMNTLTLNRHTEILEILEIPQLMDTCVRNSYHEEALELAA

YVRRLERKYSSIPVIQ GIVNEVRQSMQLMLSQLIQQLRTNIQLPACLRVIGYLRRMDVFTEAELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEAC

RVHLFDIITQYRAIFSDEDPLLPPAMGEYTVNEGAIFHGWVLQKISQFLQVLETDLYRGIGGRLDSLLGQCMYFGLSFSRVGADFRGQLAPVFQRVAIST

FQKAVEEAVEKFQDEMTSYTLISTAAILGSSNTPATVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGTLENALTK - UNI8

79 - - UNI33565 - VTKTILAFHRAEEAVFSSGEHEIFVQFCTAFLEDLVPYLNRCLQVLFPPAQIAQTLG - UNI33565 - GISPTQLSKHG

NLGHVNISAIQEPLAFILPKRETVFCLDEQELGPDLVAPAPELPAEQRSMEPVTEKREPGEPLPQEPMEGEPLPAEPPSEGGAIGSVPCPQPGEQP - U

NI33565 - 
Transcript ENSMUST00000095517
Sequence
GAGGAAGTGACGGTACCGTGCTTGAGAGATGGCGGCCGCTCTCCCTCTCCAGCCCTCCACGACCGCTTCGGCCACGACGACAGCCACGGCCGTCGCGCTG

GGGGAGGTGGAAGATGAGGGCCTCCTGGCGTCGCTATTCCGGGACCGCTTCCCCGAAGCTCAGTGGCGTGAGAAGCCCGACGTGGGCCGCTACCTCCGGG

AGCTGAGCGGCTCCGGGCTGGACCGGCTGCGGCGCGAACCCGAGCGCTTGGCGGAAGAGCGGGCCCAGCGGCTGCAGCAGACGCGCGACCTGGCTTTCGC

CAACTACAAGACGTTCATTCGCGGGGCCGAGTGCACCGAGCGCATCCACCGGCTCTTCGGCGACGTGGAGGCGTCCCTCGGGCGCCTGCTCGACCGTCTG

CCCCGCTTCCAGCAGAGCTGCAG - UNI37167 - GAACTTTGTGAAGGAAGCTGAGGAGATCAGCTCCAGCCGCCGCATGAACACGCTGACTCTAAA

CCGGCACACAGAAATCCTGGAGATTTTAGAGATACCCCAGCTTATGGACACGTGTGTCCGAAACAGCTATCATGAAGAGGCGCTGGAGCTTGCCGCCTAT

GTACGGCGACTGGAAAGGAAGTACTCCTCCATCCCCGTTATCCAG GGCATTGTGAATGAAGTGCGCCAGTCCATGCAGCTGATGCTAAGCCAGCTGATC

CAACAACTGAGGACTAACATCCAGCTCCCAGCCTGCCTCCGTGTCATAGGCTATCTTCGGCGCATGGATGTCTTCACTGAGGCTGAGTTGAGGGTGAAAT

TTCTTCAGGCTCGGGATGCTTGGCTCCGCTCCATCCTGACTGCCATCCCTAATGATGATCCTTACTTCCACATCACAAAAACCATTGAGGCTTGCCGGGT

CCATCTCTTTGATATCATCACCCAGTACCGTGCTATTTTCTCAGATGAGGACCCCCTGCTGCCACCTGCCATGGGCGAGTACACTGTGAATGAGGGTGCC

ATCTTCCATGGATGGGTGCTGCAGAAAATCTCACAGTTCCTGCAGGTGCTAGAGACTGACCTTTACCGGGGTATAGGAGGCCGCTTGGACTCTCTGCTTG

GCCAGTGCATGTACTTTGGGCTGTCCTTTAGCCGGGTGGGGGCTGATTTCCGCGGCCAGTTGGCTCCTGTTTTCCAGAGGGTGGCAATCAGCACTTTCCA

GAAAGCAGTTGAAGAAGCAGTGGAGAAATTCCAGGATGAAATGACTTCATACACCCTCATCTCGACTGCAGCCATCCTGGGCAGCAGTAACACGCCTGCC

ACAGTACCAGCCACACAACCAGGCACGCTGCAGCCACCGATGGTGCTCTTAGACTTCCCGCCTCTTGCCTGTTTCCTCAACAACATTTTGGTTGCTTTCA

ATGATTTACGTCTCTGTTGCCCTGTGGCTCTAGCACAGGATGTGACTGGGACCTTGGAAAATGCCCTTACCAAG - UNI879 - - UNI33565 - G

TAACCAAAACAATTCTGGCATTCCATCGAGCCGAAGAGGCTGTGTTCAGCAGTGGGGAGCATGAGATCTTTGTCCAGTTCTGCACTGCCTTCCTGGAAGA

CCTTGTTCCTTATTTGAACCGCTGTCTTCAAGTCCTTTTCCCACCAGCTCAGATAGCCCAGACTTTAG - UNI33565 - GCATTTCACCCACCCAGC

TCTCTAAGCACGGAAACCTTGGACACGTGAACATCAGCGCCATCCAGGAACCTCTCGCCTTTATTTTGCCTAAGAGAGAAACAGTTTTCTGTTTAGATGA

GCAGGAGCTGGGGCCGGACCTCGTGGCCCCAGCTCCAGAGCTCCCTGCGGAGCAGCGGAGCATGGAGCCTGTAACAGAGAAGAGGGAACCAGGGGAGCCG

CTGCCTCAGGAGCCCATGGAGGGGGAGCCGCTGCCAGCCGAGCCACCGAGTGAGGGAGGAGCCATAGGCAGTGTCCCCTGCCCGCAGCCTGGGGAGCAGC

CCTGAGGGTACGCGCTTCTGCAGCGGGAAGGTGTGTGCAGTTGCTTTGCCCAGGATAGCGCGGGCCCTGTGGTATTTGCAGCTTTAATAAAACCGACAAC

TGTC
Translation
MAAALPLQPSTTASATTTATAVALGEVEDEGLLASLFRDRFPEAQWREKPDVGRYLRELSGSGLDRLRREPERLAEERAQRLQQTRDLAFANYKTFIRGA

ECTERIHRLFGDVEASLGRLLDRLPRFQQSCR - UNI37167 - RNFVKEAEEISSSRRMNTLTLNRHTEILEILEIPQLMDTCVRNSYHEEALELAA

YVRRLERKYSSIPVIQ GIVNEVRQSMQLMLSQLIQQLRTNIQLPACLRVIGYLRRMDVFTEAELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEAC

RVHLFDIITQYRAIFSDEDPLLPPAMGEYTVNEGAIFHGWVLQKISQFLQVLETDLYRGIGGRLDSLLGQCMYFGLSFSRVGADFRGQLAPVFQRVAIST

FQKAVEEAVEKFQDEMTSYTLISTAAILGSSNTPATVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGTLENALTK - UNI8

79 - - UNI33565 - VTKTILAFHRAEEAVFSSGEHEIFVQFCTAFLEDLVPYLNRCLQVLFPPAQIAQTLG - UNI33565 - GISPTQLSKHG

NLGHVNISAIQEPLAFILPKRETVFCLDEQELGPDLVAPAPELPAEQRSMEPVTEKREPGEPLPQEPMEGEPLPAEPPSEGGAIGSVPCPQPGEQP

For any suggestions or comments, please send an email to unitrap@crg.es