Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031917 (Nip7)
Chromosomal location
Chr 8: 109580790 - 109582937 (+)
Description
nuclear import 7 homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1913414]
RefSeq_dna
NM_025391 
RefSeq_peptide
NP_079667.1 
UniGene
Mm.334789 
MGI
MGI:1913414 
Uniprot/SWISSPROT
Q9CXK8 
Human Ortholog
ENSG00000132603 (NIP7)
Omim not available
UniTrap UNI23675
Vector Insertion
Chr 8: 109581080 - 109581172
Public Clones not available
Private Clones OST249579 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17883
Vector Insertion
Chr 8: 109581312 - 109581946
Public Clones not available
Private Clones OST434402 (lexicon) OST423538 (lexicon) OST292116 (lexicon) OST245657 (lexicon)
OST238295 (lexicon) OST138432 (lexicon)
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23131
Vector Insertion
Chr 8: 109582088 - 109582276
Public Clones not available
Private Clones OST275444 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034392
Sequence
GGCTCTCCAGGCACGAGGATTCCCGGGAGCCAAGCAAGCGGCAAGATGAGGCCCTTGACTGAAGAAGAGACCCGGGTCATGTTTGAGAAGATCGCGAAGT

A CATCGGAGAGAACCTTCAACTCCTAGTGGACAGACCCGACGGCACGTACTGTTTCCGGCTGCACAACGACCGAGTGTACTATGTGAG - UNI23675

 - TGAGATGATGCTGAAGCTGGCCGCCAACATCTCCGGAGACAAGCTCGTGTCGCTGGGGACGTGTTTTGGGAAGTTTACCAAGACCCACAAGTTCCGC

TTGCACGTGACAGCTCTGGATTACCTGGCCCCCTATGCCAAG - UNI17883 - TATAAAGTGTGGGTAAAGCCGGGAGCAGAGCAGTCCTTCTTGTA

TGGAAACCATGTGTTGAAATCCGGTCTGGGTCGAATTACTGAGAACACATCTCAGTACCAGGGAGTGGTTGTCTATTCCATGGCGGACATTCCTCTG - 

UNI23131 - GGTTTTGGGGTGGCAGCAAAGTCTACCCAAGACTGCCGAAAAGTGGACCCCATGGCAATTGTGGTGTTCCACCAAGCAGACATTGGGGA

GTACGTACGCCATGAAGAGACACTGACTTAGGACGGTCATTCCAAGAACATTTTGCTGTGTGAGAGGACTTAGCTTTGTTTCCTGTGTGCGGCCATCAGA

TTAAATCTGGACAACACTGAGATACGCAACTTGGGTTCTTATCAACAGAAATGGCGTGAAAACAGGGTCTCTGGCCCTCTAGAGTCAAAAGCAGGTGGAT

CACAAGTATAAGGCCAGCTCAGGCTACTTGGAGAGTTCAAGGCTAGCCTGGGCTACATAGTGAGCCTTGTCTCAAAAATCTAAAACAGACAAACCAGAAC

CTGAGAGTGTTTTGTGTGAGTAAATAGAGTGTTTCTGTTTTGTGTCTGCGTCGTCTTTGTTTGGATCAGAAGACTTGCTCTGAGTGATGGTTTCTAAGTT

ACTTCACTGAGGACAGGAGCCATCTTACTGTTATCTGTGATAACACTGTTTTCCAGGCTCATGATAGCACAGTGGACTTTCTATTGTGTGTTAATGTTAA

AGGTAGAAACGGCCATATGAGCCTCTGGTTTTACATATGGAATTTAATAAATTTTAATGGTTTTATATTTGT
Translation
MRPLTEEETRVMFEKIAKY YIGENLQLLVDRPDGTYCFRLHNDRVYYVS - UNI23675 - SEMMLKLAANISGDKLVSLGTCFGKFTKTHKFRLHV

TALDYLAPYAK - UNI17883 - YKVWVKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPL - UNI23131 - GFGVAAKSTQDCRK

VDPMAIVVFHQADIGEYVRHEETLT

For any suggestions or comments, please send an email to unitrap@crg.es